KEGG   Natrialba magadii: Nmag_0667Help
Entry
Nmag_0667         CDS       T01176                                 

Definition
(GenBank) PAC2 family protein
  KO
K06869  uncharacterized protein
Organism
nmg  Natrialba magadii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PAC2
Motif
Other DBs
NCBI-ProteinID: ADD04252
UniProt: D3SZB8
Position
662163..662909
Genome map
AA seq 248 aa AA seqDB search
MARISLQGPEADLEDPTFVEGFPGIGLVGKIATDHLVDEFDMRYYASVHCQGLPRIGVYR
GGDRTARPPVRLYTSEEHDLLALQSDAPIRPEALDNVAECVTSWLIDHDATPLYLSGLPA
DRDTGERPDLYGVGTGSAPDLLDDREIDVPPEDGVVTGPTGALINHAAQAGYDSLGLVIE
CNPQFPDPEAASVLLEDAIAPLADLSVDVQELLDHAEEIREKREQLAQQMQAAGQEQSTQ
AQPLRMYQ
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atggcacgaatcagtctgcagggaccggaagccgatctcgaggaccccacttttgtcgag
ggcttcccaggaatcggactcgtcggcaagattgcgactgaccatctcgtcgacgaattc
gatatgcgctactacgcgagcgtccactgccaggggctgcctcgaattggcgtctaccga
ggtggtgaccgaaccgctcggccacctgtccggctctataccagcgaggagcacgactta
ctcgcgctacagagcgacgcgccgatccgaccggaggcgctcgacaacgtcgccgagtgc
gtgacgagctggctcatcgaccacgatgcgacgccgctgtacctgagtgggctgccagcc
gatcgagacaccggcgagcggccagatctctacggcgtcggaacggggagcgcacccgat
ctcctcgacgatcgtgagatcgacgttccaccggaggacggcgtcgtcaccggtccgaca
ggcgcgctcatcaaccacgcggcacaggccggctacgacagcctcggactcgtcatcgag
tgcaacccgcagttccccgaccctgaagcggcgagcgtgcttctcgaggacgctatcgcg
ccgctggctgacctctcggtcgacgtacaggaactcctcgaccacgccgaggagatccgt
gagaaacgcgagcagcttgcacaacagatgcaggccgccggacaggaacagagcacgcag
gcacagccgcttcggatgtatcaataa

DBGET integrated database retrieval system