KEGG   Natrialba magadii: Nmag_0669Help
Entry
Nmag_0669         CDS       T01176                                 

Definition
(GenBank) uncharacterized protein
Organism
nmg  Natrialba magadii
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADD04254
UniProt: D3SZC0
Position
complement(664463..664663)
Genome map
AA seq 66 aa AA seqDB search
MTTTNTRVDTLSKASTATTVIDAMMEFMRGRRAGGLFLLGAAALSSRIPGVGTAASLLLR
AYRRLR
NT seq 201 nt NT seq  +upstreamnt  +downstreamnt
atgacaacgacaaacactcgagtcgacacgctctcgaaggcgagcacagcgacgacggtg
atcgacgcgatgatggaattcatgcgcggccgacgagcaggcgggctcttcctcctcggg
gctgccgctctctcctcgcgaattccgggcgtcgggacggctgcctcgctgctgttgcgt
gcgtaccggcggctccgataa

DBGET integrated database retrieval system