KEGG   Natrialba magadii: Nmag_0679Help
Entry
Nmag_0679         CDS       T01176                                 

Definition
(GenBank) uncharacterized protein
Organism
nmg  Natrialba magadii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Membralin CRT10
Motif
Other DBs
NCBI-ProteinID: ADD04264
UniProt: D3SZD0
Position
complement(675707..676291)
Genome map
AA seq 194 aa AA seqDB search
MSTEESRHVYRLHSTLELPLEDLRDHIDEAAYPDGIDDVEITRRNNTLILKAVAEDQSVS
KYTPTAQLKASVTENRVYEEDPDERRQKSFSWDEEEEEEIESELVEYAAFKGDRETVLQN
SLLQYEMFLVLCEIASAAEKGTLTAISERDGELEATRIVDGETRPADIEVVEGPRDHGSG
ESGVNWRDNKFISD
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacagaggaatccagacacgtttatcggctccactcgacgctcgaactgccactc
gaagatctccgcgaccacatcgacgaggccgcctacccggacggcattgacgatgtagag
atcacgcgacgcaacaatacgctgatcctcaaggcggtcgccgaggatcagtcggtcagc
aagtacacgccaacggcccagttgaaagcgagcgtcacggagaaccgggtctacgaggag
gatccggacgagcgccgccagaagtcctttagctgggacgaggaggaagaagaggagatc
gagtccgaactcgtcgagtacgctgcgttcaagggcgaccgcgagacggtgctccagaac
tcgctgttgcagtacgagatgttcctcgtgctctgtgagatcgcatcggcggccgagaag
gggacgctgacggcgatttcggagcgcgacggcgagctcgaagcaacccgaattgtcgac
ggcgagacgcgaccggcggacatcgaagtcgtcgagggaccacgcgaccacggctccggc
gagtccggtgtcaactggcgcgacaacaagttcatcagcgactaa

DBGET integrated database retrieval system