KEGG   Natrialba magadii: Nmag_0687Help
Entry
Nmag_0687         CDS       T01176                                 

Gene name
suhB
Definition
(GenBank) putative inositol-1(or 4)-monophosphatase / fructose-1,6-bisphosphatase, archaeal-type
  KO
K01092  myo-inositol-1(or 4)-monophosphatase [EC:3.1.3.25]
Organism
nmg  Natrialba magadii
Pathway
nmg00521  Streptomycin biosynthesis
nmg00562  Inositol phosphate metabolism
nmg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nmg00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    Nmag_0687 (suhB)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Nmag_0687 (suhB)
Enzymes [BR:nmg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.25  inositol-phosphate phosphatase
     Nmag_0687 (suhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Inositol_P
Motif
Other DBs
NCBI-ProteinID: ADD04272
UniProt: D3SZD8
Position
681027..681905
Genome map
AA seq 292 aa AA seqDB search
MSNRDGDETATQREGSGATAQRRDTAAPRRATVATEAATAGADIAHDAFRTDLNIEYKDG
KTDVVTQSDRDAQDAVIDVIREFFPEDPIVGEENDALKAVPEEGPAWIIDPIDGTNNYVN
EIRAFGTAVAAVVDGEPVAATNVFPALSDTYQFGPDGVFRNGEALSVSGRTDPEASTVCP
TYWWDFDQRDEYTATARELVTRFGDIRRFGCAQLELAMVAAGALEGVVTNRRANAWDTVA
GVGMIREAGGVVTDLEGERWRHDSDGLVASNGESEIHEEVLAAARAIESEGN
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatcgcgacggcgacgagacggcaacacagcgcgagggcagcggggcaacggca
cagcgcagggacactgcagcgccacgtcgggcaactgtcgccaccgaggcggccaccgcc
ggtgccgacatcgcccacgacgccttccgaaccgatctcaacatcgagtacaaggacggc
aaaacggacgtcgtcacgcagtccgaccgcgacgcccaggacgccgtcatcgacgtcatt
cgagagttcttccccgaagaccccatcgtcggcgaggagaacgacgcgctgaaagcagtc
cccgaagagggccctgcgtggatcatcgaccccatcgacggcaccaacaactacgtcaac
gaaatccgcgcgttcggtaccgctgtcgccgccgtcgtcgacggcgaaccggtcgctgcg
acaaacgtcttccccgcactttccgacacctaccagttcggccccgacggcgtcttccgc
aacggcgaggcgctgtcggtcagcggccgcaccgaccccgaagccagcaccgtctgtccg
acctactggtgggacttcgaccagcgagacgagtacaccgccaccgcacgcgaactcgtc
acccgcttcggtgacatccgtcgctttggctgtgctcagctcgaactcgcgatggtcgcg
gcgggggcactcgagggcgtcgtgacgaacaggcgggcgaacgcctgggacacggtggcc
ggcgtcggcatgatccgcgaggcgggcggcgtcgtgacggatctcgaaggcgaacgctgg
cgtcacgacagcgacggactggtcgcatcgaacggcgagagcgagattcacgaggaggta
ctcgcggctgcgcgagcgatcgagagcgaggggaactga

DBGET integrated database retrieval system