KEGG   Natrialba magadii: Nmag_0689Help
Entry
Nmag_0689         CDS       T01176                                 

Definition
(GenBank) TrmB family transcription regulator
Organism
nmg  Natrialba magadii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TrmB MarR_2 HTH_IclR HTH_9 Rrf2 PadR
Motif
Other DBs
NCBI-ProteinID: ADD04274
UniProt: D3SZE0
Position
complement(683174..683989)
Genome map
AA seq 271 aa AA seqDB search
MDDDHIELLGELGLSGYEARAYLTLARHGSLTADEVASESDIPQGRIYDVLNSLVDRSLV
RADDGRPRTYVHVESSEAVDRLLETRVAELEDKQSSYERTASAAADALADLSHSSDSAGE
GFATSALHDQAAQDLLLERFAAADDSIRIVVDAVDIGPEWRDVFSARLADLLETGLSVRL
LASDLSSATDKLGALVDAGLAVRQVERVPQQRFIVIDGVEVCLEVVNPVADEELLAVVNF
RDNETARELAESFDELWSAAEPVPAIDGIDE
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atggacgacgatcatatcgaactgctcggcgaactcggcctctcgggctacgaagcgcgg
gcgtatctcacactcgcgcgccacggctcgctcaccgccgatgaggtcgcgagcgagtct
gacatcccacagggtcgaatctacgacgtgctgaactcactcgtcgatcgctcgctcgtc
cgcgccgacgacggacgaccgcgaacctacgtccacgtcgaatcgagtgaagccgtcgac
cgactgctcgaaacccgcgtcgccgaactcgaggacaaacaatcgtcgtacgagcgcact
gcctccgcagcagccgacgcactcgctgacctctcacactcgagtgacagcgccggcgag
gggttcgcaacgagcgcgctccacgaccaggctgcccaggacctgctgctcgagcgcttt
gccgccgcggacgactcgatccggatcgtcgtcgacgcggtcgacatcggccccgagtgg
cgtgacgtcttctcggcgcggctcgccgacctcctcgagaccgggctctccgttcgactg
ctcgcgagtgacctctcgagtgcgaccgacaaactcggcgcgctcgtcgacgccgggctg
gcggttcgtcaggtcgaacgcgttccccagcaacggttcatcgtcatcgacggggtcgaa
gtctgcctggaggttgtcaaccccgttgcggacgaggagctactcgcggtggtcaacttc
cgggacaatgagacggcacgcgagttggcagagagcttcgacgaactctggtcggctgcc
gaaccggtgccggcaatcgacggtatcgacgagtaa

DBGET integrated database retrieval system