KEGG   Natrialba magadii: Nmag_0690Help
Entry
Nmag_0690         CDS       T01176                                 

Definition
(GenBank) uncharacterized protein
Organism
nmg  Natrialba magadii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NPCBM_assoc CARDB PHTB1_C DUF3426
Motif
Other DBs
NCBI-ProteinID: ADD04275
UniProt: D3SZE1
Position
684073..685986
Genome map
AA seq 637 aa AA seqDB search
MRRTYLVGLLLVLLSIGLVAGSPLIVAASENPDFDVYLPENIVEPGEETAIELEIRNGAS
AEDDTEVGDTPPGDARDVTVDVSTADDDIPVSVQTETTPMPTMSSQMLLSESFDIVVDEN
ASAGSYELEVEIDYTYTTSGGSERTSTDTETVEIVVDDRARFDADLIKSELIVGDRGTVQ
LELTNTGVENASDAVVQFGAADQNLQTVTPTTEESELSTGTEEYIGDWEINETVTATANM
ELADDAVARTYPVTAAVEFRDEEGVDQTSRELRVGAPTKDQQSFALENVSSDLAVGEDGT
VKGELTNKGPNPVDGAVIVVDDSGGNDIVPDLDDSLGSGSNVYPREGQYAVGQLEPGESA
PFEFRIGVGSEAEPGPRVIETDVRYRNAADEVRTTTEPLDATVDVAPERDEFALEALNAT
FERDSGGDVELTVTNQLDETVTDIEAKLFTNDPLDSSDDEAFIPALESGESATVVFDVSV
EDSAMAQTYPLRLDFRYDDARSNSQLTDTYRVPIDVVEPKDDGLSTQALLAILGVVGGVG
AAVWWFRDRLATAVEGVPVLGRLAAITIPNPLARLRGSEAESGDDSAVETRFSEPDDGSE
RGSVSDGTGSTPDDTDVLDDRTAAQKEAEPDPAETDH
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgagacggacgtacctcgtcggcctgcttctggttttgctttcgatcggactcgtggct
ggctcgccgctgatcgtcgcggcgtccgaaaatcccgacttcgacgtgtatctccccgaa
aatatcgtcgaaccgggtgaggagactgcaatcgaactcgagatccggaacggcgcgtcc
gccgaggacgacactgaggtcggagacacgccacctggcgacgctcgtgacgtcaccgtc
gacgtcagcacggcggacgacgatataccggtctccgtacagacggagacgacgccgatg
ccgaccatgtcgagccagatgctgctctccgaatcgttcgacatcgtcgtcgacgaaaac
gcgtcggccggtagctacgaactcgaggtcgaaatcgactacacctacacgacttccggc
ggttcggagcgcaccagtactgataccgaaaccgtcgaaatcgttgtcgacgaccgcgca
cgattcgatgccgacctcatcaagtcggaactcatcgtcggcgaccgcgggacggtccaa
ctcgagttgaccaacactggcgtcgagaacgcgagcgatgcggtggttcagttcggcgcg
gccgaccagaacctccagacggtcacgccgacgaccgaggagtcagagctctccaccggg
acagaagagtacatcggcgactgggaaatcaacgagaccgtgacggcgaccgcgaacatg
gaactcgcggatgacgccgtcgcacgcacgtatccggttaccgccgccgtcgagttccgc
gacgaggagggtgtcgaccagacctcgcgcgaactccgcgtcggcgcgccgacgaaggat
caacagtcgttcgccctcgagaacgtttccagcgacctcgcggtcggcgaggacggcacg
gtgaagggcgaactcaccaacaagggtccaaaccccgtcgacggtgcggtcatcgtcgtc
gacgacagcggtggcaacgacatcgttccggacctcgatgacagcctcgggagtggctcg
aacgtctatccgcgcgagggacagtacgcggttggccaactcgaacccggcgagtccgcg
ccgttcgagttccgtatcggcgtcggtagtgaggccgaacccggcccgcgcgtgatcgaa
accgacgtacgctatcgtaacgccgcagacgaggtccgtacgacgaccgaaccgctcgac
gcgacggtcgacgttgcccccgagcgcgacgagttcgcgctcgaagcgctgaacgcgacg
ttcgaacgcgatagcggcggcgacgtcgaacttacggtgacgaaccaactcgacgaaacg
gtgaccgacatcgaggcgaaactgttcacgaacgatccactcgacagcagcgacgacgag
gcgttcatcccggcactcgagtccggcgagtctgcgacggtcgtcttcgacgtctcggtc
gaggacagcgcgatggcgcagacgtatccgcttcggctcgacttccggtacgacgacgcg
cggtcgaactcacagctgacggacacctaccgggtgccgatcgacgtcgtcgaacccaaa
gacgacggactctcgacccaggcactgctggccatcctcggcgtcgttggcggcgtcggg
gctgcggtctggtggttccgtgatcggctcgcaaccgccgtcgagggcgttcccgtgctc
ggtcgactcgctgcgatcacgattccgaacccgctcgcacgccttcggggttccgaagcg
gagagcggcgacgactcggccgtcgagacgcggttcagcgagcccgacgacggaagcgaa
cgtggatccgtgagcgacggcacgggctcgacgccggacgatactgacgtgctcgacgac
cgaacggccgcccagaaggaggccgaaccagaccccgccgagaccgaccactga

DBGET integrated database retrieval system