KEGG   Natrialba magadii: Nmag_0696Help
Entry
Nmag_0696         CDS       T01176                                 

Definition
(GenBank) uncharacterized protein
Organism
nmg  Natrialba magadii
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADD04281
UniProt: D3SZE7
Position
694337..694474
Genome map
AA seq 45 aa AA seqDB search
MVEVRIEFDDDEQYERLKELKKHRGLTWKGLLLEGEKKVREDTPE
NT seq 138 nt NT seq  +upstreamnt  +downstreamnt
atggtcgaagtccgcatcgagttcgatgacgatgaacagtacgagcggttgaaagaactg
aagaagcaccgcgggttgacgtggaagggattgctccttgagggcgaaaagaaagtccgg
gaggataccccggagtaa

DBGET integrated database retrieval system