KEGG   Natrialba magadii: Nmag_0705Help
Entry
Nmag_0705         CDS       T01176                                 

Definition
(GenBank) homolog to orotate phosphoribosyltransferase
  KO
K00762  orotate phosphoribosyltransferase [EC:2.4.2.10]
Organism
nmg  Natrialba magadii
Pathway
nmg00240  Pyrimidine metabolism
nmg01100  Metabolic pathways
Module
nmg_M00051  Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:nmg00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    Nmag_0705
Enzymes [BR:nmg01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.10  orotate phosphoribosyltransferase
     Nmag_0705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pribosyltran HTH_23 HTH_7 HTH_11 GerE HTH_38 PRTase_2 Sigma70_r4 HTH_24 UPRTase MarR_2
Motif
Other DBs
NCBI-ProteinID: ADD04290
UniProt: D3SZF6
Position
complement(703438..704115)
Genome map
AA seq 225 aa AA seqDB search
MKNVDDLIESAAELAARGLSKGEIADELNVSRETASWLVERSDATTQSESDDGAVDTAST
TDTATENGSRPQDIHVDWSAIGRDSKRLSHVAAAMADLLAKHGEDVDLTIGIEKAGGPVA
TLVARELETDLGTYTPSKHQWEEGDIENLGGTFSRNFAGIRNRECYIVDDTITSGTTMRE
TIEAIRAEGGEPLACVVLADKQGIEEIEGVPVYSLLQVISVGTDE
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgtcgacgatctcatcgagagcgctgccgagctggctgcgcgcgggctttcg
aagggcgaaatcgcagacgaactgaacgtctcccgcgaaactgcaagctggctcgtcgag
cgcagtgatgcgacgacgcagtcggagtcagacgacggcgcagttgacactgcatcgacg
acggataccgccacggagaacggaagccgtccacaggacattcacgtcgactggtccgcg
atcggtcgcgacagcaagcggctgagccacgtcgctgctgcgatggccgacctgctcgcc
aaacacggcgaggacgtcgacctgacgatcggaatcgagaaggccggcggcccggtcgcc
acgctcgttgcgcgggaactcgagacggatctcggcacgtacacgccttcgaaacatcag
tgggaagaaggtgatatcgagaacctcggtgggacgttttcccggaacttcgccggaatc
cgcaaccgcgagtgctacatcgtcgacgacaccattacgagcgggacgacgatgcgcgag
acgatcgaagcgattcgcgcggaaggtggcgagccgcttgcctgtgtcgtgctcgcggat
aagcaggggatcgaggaaatcgaaggtgtgccggtgtactcactcttgcaggttatcagc
gtcggcacagacgagtaa

DBGET integrated database retrieval system