KEGG   Natrialba magadii: Nmag_0707Help
Entry
Nmag_0707         CDS       T01176                                 

Definition
(GenBank) HAD superfamily hydrolase
  KO
K01091  phosphoglycolate phosphatase [EC:3.1.3.18]
Organism
nmg  Natrialba magadii
Pathway
nmg00630  Glyoxylate and dicarboxylate metabolism
nmg01100  Metabolic pathways
nmg01110  Biosynthesis of secondary metabolites
nmg01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:nmg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Nmag_0707
Enzymes [BR:nmg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.18  phosphoglycolate phosphatase
     Nmag_0707
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like HAD Acid_PPase
Motif
Other DBs
NCBI-ProteinID: ADD04292
UniProt: D3SZF8
Position
705636..706208
Genome map
AA seq 190 aa AA seqDB search
MRPPLLHRTVTEYDAIVYDLDGTLVDLDVDWNAVAADVKALYADSNVEPPSDDLWAMLEW
AANAGLADAVEEAIAAHERAGAPTSPRLAHADELANGMATTPVGVCSLNCEAACRRALES
HGLVSAVDVIVGRDTVETQKPDPEPLLVAVDELGVEPSDAVFVGDSARDEQTARRAGVEF
EYVGDGPSGV
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgcgcccgccactccttcacagaactgtgaccgagtacgacgcgatcgtctacgatctg
gatggcacgctcgtcgatctcgacgtcgactggaacgccgtcgctgcagacgtcaaagca
ctctatgccgactccaacgtcgaaccgccgagtgacgacctctgggccatgctcgagtgg
gcagccaacgctggtctcgcggatgccgtcgaagaagccatcgcagcccacgagcgtgcc
ggcgcaccgacctcaccccgactcgcgcacgcggacgaacttgcaaacggtatggcgacc
acgcctgtcggcgtctgctcgctcaactgcgaggctgcctgccgacgggcactcgagtcc
cacgggctcgtgtcggcggtggacgtgatcgttggccgtgacacagtcgagacgcagaag
ccggatccggagccgttgctcgttgcggtcgacgaactcggtgtcgaaccgtcagatgca
gtctttgtcggcgattcggcgcgggacgagcagacggccaggcgagccggcgtcgagttc
gagtacgtgggcgacggcccgtcgggtgtctga

DBGET integrated database retrieval system