KEGG   Natrialba magadii: Nmag_0710Help
Entry
Nmag_0710         CDS       T01176                                 

Definition
(GenBank) uncharacterized protein
Organism
nmg  Natrialba magadii
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADD04295
UniProt: D3SZG1
Position
complement(707570..708142)
Genome map
AA seq 190 aa AA seqDB search
MADQSPSDDPNERTGEESDENDEWNPRLPSDVLADTFLRAENGRVITFNVLLFATIAIGF
GVPPVLYNIFAGFGGSFGMEGEIESLHIVVDAIGSAILLAPVVATLTGVLTGIQFDQPPS
AVGTLGAIGAVAGFVVFCLLLFVLGSLSGMPSNPLLSALTEDLFFPVTMIVGVALAAFGA
AATASAFSRR
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atggctgatcagtcgccgagcgatgacccgaacgagagaacaggcgaggagagcgacgag
aacgacgagtggaacccccgcctccccagtgacgtgctcgcagacaccttcctccgggcg
gaaaacgggcgggttatcacgttcaacgtgctcctgttcgcgaccatcgcgatcggattc
ggtgttccaccagtcctgtacaacatcttcgccgggttcggtggttccttcgggatggaa
ggtgaaatcgagagcctccacatcgtggtcgatgcgatcggctctgcaattttgctcgca
cccgttgtggcgaccctgaccggcgtcctcaccgggattcagttcgaccagccgccgtcc
gccgttggaacgctcggtgccatcggtgcagtcgccggcttcgtggtgttctgtctgctc
ttgttcgttctcggctcactcagcggcatgccgtcgaacccactgctcagcgcgctcacc
gaggatctattctttcccgtcacgatgatcgtcggagtcgcgctcgctgcgttcggtgcg
gcggctaccgcgagtgcgttttcccgacgctaa

DBGET integrated database retrieval system