KEGG   Natrialba magadii: Nmag_0713Help
Entry
Nmag_0713         CDS       T01176                                 

Definition
(GenBank) DUF88 domain protein
Organism
nmg  Natrialba magadii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NYN CoA_binding_2 Peripla_BP_4
Motif
Other DBs
NCBI-ProteinID: ADD04298
UniProt: D3SZG4
Position
complement(709451..709915)
Genome map
AA seq 154 aa AA seqDB search
MFDRVRARLAPDTDSHREPAVGLFVDGPNVFRDEFDVDLDDLRDVAGGLGRVGVIRLYLD
EHATPGLIQAAEARGFEVVITSGDVDVKLAVDATALSTDQTIDTLAIASRDTDFKPVLEH
AAAQGIETIAIAPGSHGRSDALQNAADEAITLGS
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaccgcgttcgcgcccgtctcgctcccgataccgactcccaccgcgagccagcc
gttgggctgttcgtcgacgggccgaacgtcttccgcgacgagttcgacgtcgatctcgac
gaccttcgggacgttgccggcggcctcggacgcgtcggcgtgatcaggctctatctcgac
gaacacgccacgccagggctcattcaggcggctgaagcgcgcggcttcgaggtcgtcatc
acgagcggcgacgtcgacgtgaaactggctgtcgacgcgactgcgctctcgaccgaccaa
acgatagacacgctcgcgatcgcctcgcgcgataccgacttcaaacccgttctggaacac
gcggcggcgcagggaatcgagacgatcgcaatcgcacccggttctcacgggcgctctgat
gcgttgcaaaacgcggcagatgaggcgataacgcttggttcgtga

DBGET integrated database retrieval system