KEGG   Natrialba magadii: Nmag_0719Help
Entry
Nmag_0719         CDS       T01176                                 

Definition
(GenBank) uncharacterized protein
Organism
nmg  Natrialba magadii
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADD04304
UniProt: D3SZH0
Position
717576..717953
Genome map
AA seq 125 aa AA seqDB search
MTVVGIARSQAVDGGAGVDVKADVDVEAEADVDAEADVDAEADVDANADFRDTTEDAPTA
STESDTSSLVIAARNPSTELFIESGPERTALARAWYRGTAARGLCWGATAVAAGSAALWW
MTLTW
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
gtgacggtcgtgggtattgcgcggtcgcaggcggtcgatgggggtgcgggcgtggatgtg
aaggcggatgtggatgtggaggcggaggcggatgtggatgcggaggcggatgtggatgcg
gaggcggatgtggatgcaaatgcagatttccgtgataccacagaggacgctccaacagcg
tccacagagtcggacacatcttcactcgtcatcgcagcccggaacccgtcgacagaactg
ttcatcgagagcgggcccgaacggaccgcactcgcccgggcgtggtatcgcggaacggcc
gctcgcggattgtgctggggagcaacagcggtcgccgctggcagcgcagcactgtggtgg
atgacactcacctggtga

DBGET integrated database retrieval system