KEGG   Natrialba magadii: Nmag_0722Help
Entry
Nmag_0722         CDS       T01176                                 

Definition
(GenBank) small CPxCG-related zinc finger protein
Organism
nmg  Natrialba magadii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NOB1_Zn_bind RecR
Motif
Other DBs
NCBI-ProteinID: ADD04307
UniProt: D3SZH3
Position
complement(719089..719289)
Genome map
AA seq 66 aa AA seqDB search
MATTDGVSNGMTEPCEVCGIDTLHEVSVQLVTEGGEGANARYSREPYRVRECQRCGNRES
KRMNNA
NT seq 201 nt NT seq  +upstreamnt  +downstreamnt
atggcaacgactgatggtgtgtcaaacgggatgaccgagccgtgtgaggtttgcggaatt
gacacgttacacgaagtttctgtgcagctcgttactgaaggcggcgaaggagccaacgcg
cgctattcgcgcgaaccgtaccgcgttcgcgagtgccagcgctgtggtaaccgagagagc
aagcgaatgaacaacgcataa

DBGET integrated database retrieval system