KEGG   Natrialba magadii: Nmag_0723Help
Entry
Nmag_0723         CDS       T01176                                 

Definition
(GenBank) ArsR family transcription regulator
Organism
nmg  Natrialba magadii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_20 HTH_5 MarR_2 HTH_24 HTH_11 TrmB HTH_IclR HTH_AsnC-type MarR PadR ArsR FUR HTH_22 TFIIE_alpha HTH_27 HTH_28 Fe_dep_repress Rrf2 DUF2089 HTH_Crp_2 HTH_30
Motif
Other DBs
NCBI-ProteinID: ADD04308
UniProt: D3SZH4
Position
719530..719880
Genome map
AA seq 116 aa AA seqDB search
MNEESSIEEILDTIGDEHARTILASISREPGSAKELSERLDLSQPTIYRRLDVLKENELI
KDRTLVADDGNHYKEYTCNFNSTVISLEDDEYDVRIFREENLPDRFTRLWDELGVQ
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaggagtcctccatcgaggaaattctcgatacgatcggggacgagcatgcgcgc
accatactcgcctcgatcagccgcgagccgggctcagcgaaggagctctcagaacggctc
gacctctcgcaaccaacgatttaccgtcgtctcgacgttctcaaagagaacgaactgatc
aaagaccgcacgctcgtcgccgatgacggcaaccactacaaggaatatacctgtaacttc
aacagcacggtcatctcgctggaagacgacgaatacgacgttcggatcttccgagaggaa
aacctccccgaccggtttacgcgcctgtgggacgaactcggtgtccagtag

DBGET integrated database retrieval system