KEGG   Natrialba magadii: Nmag_0725Help
Entry
Nmag_0725         CDS       T01176                                 

Gene name
cinA2
Definition
(GenBank) CinA N-terminal domain protein
Organism
nmg  Natrialba magadii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MoCF_biosynth
Motif
Other DBs
NCBI-ProteinID: ADD04310
UniProt: D3SZH6
Position
complement(720493..721248)
Genome map
AA seq 251 aa AA seqDB search
MNVALLTVGDELLAGQTTNTNASWLAARLSERGATVRRILTVPDDRELIASTVARWHDNP
EFDAIIVTGGIGGTPDDVTVPAVADGLDREFVVFEEIYDRLREKAAAFREENPDLVADYD
LQLDLEAAASLPEGATPIVVDEGWAPGCVVDGVYVFAGIPDEMRAMFDTVVDEFSGEAIA
RTIYTPAPEGSLHDVLESVTNEFDVSVGSYPRSEQRPGRIRVTGTTEESVDAAVSWVESR
VETVEPAFESE
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtcgcactcctcaccgtcggcgacgaactcctcgccgggcagacgacgaacacc
aacgcctcctggctcgccgcccggctcagcgagcgcggcgcgaccgtcaggcgcattctg
acggtgcccgacgaccgcgaactcatcgcgagcaccgttgcccgctggcacgacaacccc
gagttcgacgcgatcatcgtcaccggcggcatcggcggcacgcccgacgacgtcaccgtt
cccgcggtggccgacggcctcgaccgcgagttcgtcgttttcgaggagatttacgaccga
ctgcgcgagaaagccgccgcgttccgggaggaaaacccggacctggtcgccgactacgac
ctccaactcgacctcgaggctgccgcctcgctccccgagggtgcaacacccatcgtcgtc
gacgagggctgggcccccggctgcgtcgtcgacggcgtctacgtcttcgccggcatcccc
gacgaaatgcgcgcgatgttcgacaccgtcgtcgacgagttctccggcgaggccatcgcg
cggacgatctacacccccgctcccgagggctcgctgcacgacgtactcgagtccgtcacg
aacgagttcgacgtcagtgttgggagctatccgcgcagcgagcagcgaccagggcggatt
cgggtcacgggaacgaccgaggaatcggtcgacgcggcggtatcgtgggtcgagtcgcgt
gtcgagacagtagaaccagcgttcgagtcggagtga

DBGET integrated database retrieval system