KEGG   Natrialba magadii: Nmag_0729Help
Entry
Nmag_0729         CDS       T01176                                 

Gene name
rfcB
Definition
(GenBank) replication factor C large subunit
  KO
K04800  replication factor C large subunit
Organism
nmg  Natrialba magadii
Pathway
nmg03030  DNA replication
Brite
KEGG Orthology (KO) [BR:nmg00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    Nmag_0729 (rfcB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:nmg03032]
    Nmag_0729 (rfcB)
DNA replication proteins [BR:nmg03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (archaeal)
    RFC (replication factor C)
     Nmag_0729 (rfcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA RuvB_N Rad17 AAA_22 AAA_assoc_2 AAA_33 AAA_16 AAA_5 AAA_25 DUF1314 Hydin_ADK AAA_18 RsgA_GTPase AAA_28 Viral_helicase1 RNA_helicase IstB_IS21 Zeta_toxin NACHT IPT DUF815 AAA_3
Motif
Other DBs
NCBI-ProteinID: ADD04314
UniProt: D3SZI0
Position
722679..724223
Genome map
AA seq 514 aa AA seqDB search
MSDWTETYRPTTLSEVRGNNKARDKLKEWAETWDDHQDAVIVHGSPGVGKTSAAHALAND
LGWPVMELNASDSRGADVIERIAGEAAKSGTLTGGESGRRLVILDEADNFHGNADYGGSR
EVTRVVKSANQPIVLVANEFYDMSQSLRNACETIEFRDVSKRSIVPVLRDICRREDIEFE
DDALQKIAEDTSGDLRSAVNDLQAVAEEAERLTVDDVVTGDRDTTEGIFDFLDTLIKEED
AEGALKASYDVDENPDEMLNWIEDNVPKDYQGAELADAYEFLANADRWLGRVRSTQNYSF
WRYASDNMTAGVAASRREPKGGWTRYGPPSYWRKLGSSKGTRKTRDAIAERIAEREGTSV
GTARREIMPFLSAMTHHCKNRDLTVQMAAAYELDEKEVSFVTGSGKSTNKVQSIVEDAEE
LLTEQTVEHSGSAFFDTSDSDSDSTAATDAESLADDEASQAASDGQGQGQGQETLVSAGE
DGTGSSSEEPDDEPAETGSPDETDDDQSGLNDFF
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgagcgactggaccgagacgtaccgcccgacgacgctgtcggaggtacgcgggaacaac
aaggcccgtgacaaactcaaagagtgggccgagacctgggacgaccatcaggacgcggtg
atcgtccacgggagccccggcgtcgggaagacctcggccgcccacgcgctggcgaacgat
ctgggatggcccgtgatggaactcaacgccagcgacagccgcggagccgacgtcatcgag
cgcatcgccggcgaggccgcaaagagcgggacactcaccggcggcgagtcgggccgacgg
ctggtcattctggacgaagcggacaacttccacggcaacgccgactacggcggctcacgg
gaggtcacccgcgtcgtcaagagcgcaaaccagccgatagtgctcgtggccaacgagttc
tacgacatgagccagagcctccgcaacgcctgcgagacgatcgagttccgcgacgtttcg
aagcgctcgatcgtccccgttttgcgggatatctgccgccgcgaggacatcgagttcgag
gacgacgccctgcagaagatcgccgaagacacgagcggcgaccttcgttccgcggtcaac
gacctccaggcagtcgccgaggaagccgagcgactgaccgtcgacgacgtggtgactggt
gaccgtgacacaacggaaggcatcttcgactttctggacacgctcatcaaggaagaagac
gccgaaggagcactcaaagcgtcctacgacgtcgacgagaatccagacgagatgctgaac
tggatcgaagataacgtccccaaggactaccagggtgctgaactggcggacgcctacgag
ttcctcgcgaacgccgaccgctggctgggtcgggttcgctcgacgcagaactactcgttc
tggcgctacgcctcggacaacatgactgccggcgtcgcggcctcccgccgcgagccgaaa
ggcggctggacccggtacggaccaccgagctactggcggaaactcggcagcagcaagggc
acgcgcaagacacgcgacgcaatcgccgagcggatcgccgagcgcgaggggacgagtgtc
gggaccgcccgccgagagatcatgccgttcctctcggcaatgactcaccactgcaagaat
cgggacctgaccgtgcaaatggccgcggcgtacgaactcgacgagaaggaggtctcgttc
gtgacgggaagtggaaagagcaccaacaaggtccagtcgattgttgaggacgccgaagag
ctgctcaccgagcagacggtcgaacactccggctctgcgttcttcgatacgtccgattcg
gacagcgattcaacagcggcgacggacgcggagtcgctggccgacgacgaggcgtcccag
gcagccagcgatggccagggacagggacaaggacaggaaacgctcgtctctgcgggtgaa
gacgggaccggttcgtccagcgaagaaccggatgacgaacctgccgaaacgggttcccca
gacgagaccgacgacgatcagtccggcctgaacgacttcttctga

DBGET integrated database retrieval system