KEGG   Natrialba magadii: Nmag_0734Help
Entry
Nmag_0734         CDS       T01176                                 

Definition
(GenBank) uncharacterized protein
Organism
nmg  Natrialba magadii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Tmemb_40
Motif
Other DBs
NCBI-ProteinID: ADD04319
UniProt: D3SZI5
Position
729133..729423
Genome map
AA seq 96 aa AA seqDB search
MGKEYRTTPEPPEEPTERSFTDADESVTAVRRGAWVATSSLFGLAFLVVALMQVTRLVAT
SSPYDGFGLVDGFVIGVVVLAFIAGLVIGRRELAAG
NT seq 291 nt NT seq  +upstreamnt  +downstreamnt
atggggaaagaataccgaacgacgcccgaaccaccagaagagcccacagaacggagcttc
acagacgcggacgagtcggtgacggcggtgcgacgcggtgcctgggttgcaacctcgtcg
ctgttcggtctcgcgtttctcgtcgtcgcactgatgcaggtgacgcgactggttgcgacg
tcctcaccctacgacggatttggtctcgtcgacggcttcgtgatcggtgtcgtcgtcctc
gcgtttatcgcggggctggtcatcggccgccgcgaactcgcagcaggatag

DBGET integrated database retrieval system