KEGG   Natrialba magadii: Nmag_0735Help
Entry
Nmag_0735         CDS       T01176                                 

Definition
(GenBank) site-specific DNA-methyltransferase
Organism
nmg  Natrialba magadii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: N6_N4_Mtase UPF0020 Cons_hypoth95 PCMT
Motif
Other DBs
NCBI-ProteinID: ADD04320
UniProt: D3SZI6
Position
729733..730608
Genome map
AA seq 291 aa AA seqDB search
MGEIDQAVNALPSHHELHRGDARDLSMVPEESIELVVTSPPYFDIKDYENGTGGENQLGD
IEGYEAFNDEIDRVWEQCYEKLVPGGRMCIVVGDVLRSRSDYGRHRVLPLHATIQERCTD
IGFDNLAPIIWYKIGNSSLEAGGNARFLGKPYEPGAVIKNDIEYILLFRKPGDYRSPTVA
ERVLSLIEADRHQTMFRQLWTDITGEAQTDHPAPYPATLAERLIRMFSFVTDTVLDPFAG
SGSTAVGATRCGRDSISVELEEEYFEIAKRRVERERGTLTNYRNVSVETSR
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgggggagatcgatcaggccgtcaacgcgctgccgtcacaccacgaactccaccgcggc
gacgcgcgggatctgtcgatggtgcccgaggagagcatcgaactcgtcgtcacctcgccg
ccgtacttcgatattaaagactacgagaacggcaccggtggcgagaaccagctaggcgac
atcgagggctacgaggcgttcaacgacgaaatcgaccgcgtctgggagcagtgctacgaa
aagctcgtccccggcggccgtatgtgtatcgtcgtcggcgacgtgctccgctcgcgcagt
gactacggccgccaccgcgtgctcccgctgcacgccaccattcaggagcgctgtaccgat
atcggcttcgacaacctcgcgccgatcatctggtacaagattggcaactcgagtctcgaa
gccggcggcaacgctcgctttctcggcaaaccgtacgaacccggtgccgtcatcaaaaac
gatatcgagtacattctgctctttcgcaaacccggggactaccgctcgccgacggtcgca
gagcgcgtgctgagcctgatcgaggccgaccgccatcagacgatgttccgccagctctgg
accgacatcaccggcgaagcacagaccgaccaccccgcgccctaccccgcaacgctcgcc
gaacgacttatcaggatgttctcgttcgtcaccgacaccgtcctcgatccgttcgccggt
tccggctcgaccgccgtcggcgcgacccgctgtggccgcgactcgatttcggtcgaactc
gaggaggagtacttcgagatcgcgaagcggcgggtcgaacgcgagcgagggacgctgacg
aattatcggaacgtgtcggtggagacgtctcgatag

DBGET integrated database retrieval system