KEGG   Natrialba magadii: Nmag_0752Help
Entry
Nmag_0752         CDS       T01176                                 

Definition
(GenBank) DUF4157 domain protein
Organism
nmg  Natrialba magadii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4157
Motif
Other DBs
NCBI-ProteinID: ADD04337
UniProt: D3SZK3
Position
complement(749071..750369)
Genome map
AA seq 432 aa AA seqDB search
MSAQTHSTEYSKTALIRSSSAGKWSIEHWKRSRNADSDDETSDTSRAQTADTASSSAAVW
DGSPKPLAAADLEHARVETHLEAATFDNSAAAVDLADSAVPRLFGRDEAQIQRSLEGTDT
TIDEVPGKVLDVLSNGGQPLNQPVQRALEERMDADFSDVRLHTGGTAAKAAEAIDAKAFT
CGNDIVFNSGEYDPESPEGQHLLAHELAHVKQQNGGAPISMMPQEGANLEIDPDPQLERE
ADAAAEQALSGEEPLVVSRMGTDVHIQRMPAGAPVKGAEGGAGLAGRVSAIEESLSELEP
LKSLADRTDELKAQLDGSGDGGVAKKVGAAGIWGSVGAALTQAQHAGADALGVESLLGNL
TGDAHADAVLGTVIAGTTAAKVTGGKEGISALKKRAKAWFSEWRAKSDEDDQKSREEDES
EGTLDSVRNLVG
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcacagacccacagtactgagtactcgaaaactgcactaatacgttcgagttcc
gcgggcaagtggtccatagaacactggaagcgctcccggaacgcggactcggacgacgag
acgagcgacacgtcacgggcacagactgccgacacggcgtcttcgtcagccgctgtctgg
gatggaagccccaaaccgctggcggcggctgacctcgagcatgcccgggtggagactcac
ctcgaggcagcgacgttcgacaactccgctgcagccgtggatctcgctgattcggcggtt
ccacgactattcggccgtgacgaggctcagattcagcgctcgctcgagggaaccgacacg
accatcgacgaggttcccggcaaggttctggacgtgctgagcaacggtggccaaccactg
aatcagcccgttcaacgcgccctcgaggagcggatggacgccgatttctcggacgtacgc
cttcacacgggcggcactgcagcgaaagctgctgaggcgatcgacgcgaaggcgtttacc
tgcgggaacgatatcgtgttcaactcgggcgagtacgatcccgaaagtccggagggccag
cacttgctcgcgcacgaactcgcccacgtcaaacaacagaacggtggcgcgccgatttcg
atgatgccccaggagggcgctaatctcgagattgaccctgatccgcaactcgagcgcgag
gccgacgcggcggccgagcaggcactctccggtgaggagccgctagtcgtgagtcggatg
gggacggatgtccacattcagcggatgcctgccggtgctccagtgaaaggtgcagaaggt
ggcgcgggcctggccggccgggtgagtgccatcgaggagtcactgagtgaactggagccg
ttgaagtcactggccgatcggaccgacgagctcaaagcacaactggacggttcgggcgac
ggcggggtcgcgaagaaagttggcgcggccggtatttggggcagcgtcggtgccgcactc
acccaggctcagcatgctggtgctgacgccctcggcgtggaaagcctacttggcaatctt
accggagacgctcacgccgacgccgttctcggaacggtcattgccgggaccaccgccgcg
aaggtcactggcggcaaagaaggcatctccgcgctcaaaaagcgcgccaaagcgtggttc
tccgagtggcgcgccaagagtgacgaagacgatcagaaatcccgtgaagaagatgagagt
gaaggaacgttggattcggttagaaacttggtggggtga

DBGET integrated database retrieval system