KEGG   Natrialba magadii: Nmag_1781Help
Entry
Nmag_1781         CDS       T01176                                 

Gene name
ltaE
Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
nmg  Natrialba magadii
Pathway
nmg00260  Glycine, serine and threonine metabolism
nmg01100  Metabolic pathways
nmg01110  Biosynthesis of secondary metabolites
nmg01120  Microbial metabolism in diverse environments
nmg01130  Biosynthesis of antibiotics
nmg01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nmg00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Nmag_1781 (ltaE)
Enzymes [BR:nmg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     Nmag_1781 (ltaE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5 DegT_DnrJ_EryC1 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: ADD05355
UniProt: D3SUU7
Position
1812528..1813541
Genome map
AA seq 337 aa AA seqDB search
MIDFRSDTVTTPDDRMREAARDAEVGDDVYREDPTVAELESRVAARLGTEAAIYCPTGTM
ANQIAGRVHTERGQEVLADRKSHVVKYELGGFADLAGLQVRMLDTDRGVPTPEQVEAGLV
EEGLHRPGTGLLCLENTHNARGGLAIDPEKIAAAAEVAHENDVPVHLDGARVFNAATALD
VPVAEIVDPVDTVMVSLSKGLGAPVGSMLAGSEAFIDEARRTRKLLGGGMRQAGIIAGPA
LCALENVESLATDHENARALADGLDEIDGFDVQPPETNIVLADVAGTGLDTAAVLERLEE
QDVLATAFGPTTVRFCTHRDVSAADVEAALERIEATF
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgatcgactttcgctcggataccgttacgacacccgacgatcgaatgcgcgaggccgca
cgggacgccgaggtcggcgacgacgtctaccgcgaggacccaactgtggccgaactcgag
tcccgcgtcgctgcacggctcggcaccgaggctgcgatctactgcccaacgggcacgatg
gcgaaccagatcgccggccgcgtccacaccgagcgtggacaggaagtgctcgcagaccgc
aagagccacgtcgtgaaatacgaactcggcggctttgcagacctcgccggcctgcaggtg
cggatgctcgacaccgaccggggcgtcccgacgccagaacaggtcgaggccggcctcgtc
gaggagggactccaccggcccggcaccggcctgctctgcctcgagaacacccacaacgcc
cgcggcggcctcgcgatcgatcccgagaagatcgctgccgcagccgaggtggcccacgag
aacgacgtgccggtccacctcgacggcgcgcgcgtgttcaacgccgcgacagcgctcgac
gttcctgtcgccgaaatcgtcgacccagtcgacaccgtcatggtctcgctctcgaagggc
ctcggcgcaccggtcggctcgatgctcgccggctccgaggcgttcatcgacgaggcccgc
cgcacccgcaaactcctcggcggcggcatgcgccaggccggcatcatcgccggcccggca
ctctgtgcactcgagaacgtcgagtcactcgcgacggatcacgagaacgcccgcgcgctc
gcggacgggctggacgagatcgatggcttcgacgtgcaaccgccggagacgaacatcgtc
ctcgcggacgttgccggcaccgggctcgacactgcggcggtactcgagcgcttggaagaa
caggacgtgctggcgacggcgttcggcccgacgacggttcggttctgtacgcaccgcgac
gtgtcggcggccgatgtcgaggcggcactcgagcggatcgaggcgacgttctga

DBGET integrated database retrieval system