KEGG   Natrialba magadii: Nmag_2141Help
Entry
Nmag_2141         CDS       T01176                                 

Gene name
gap1
Definition
(GenBank) glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) (phosphorylating)
  KO
K00150  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
nmg  Natrialba magadii
Pathway
nmg00010  Glycolysis / Gluconeogenesis
nmg01100  Metabolic pathways
nmg01110  Biosynthesis of secondary metabolites
nmg01120  Microbial metabolism in diverse environments
nmg01130  Biosynthesis of antibiotics
nmg01200  Carbon metabolism
nmg01230  Biosynthesis of amino acids
Module
nmg_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
nmg_M00002  Glycolysis, core module involving three-carbon compounds
nmg_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:nmg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nmag_2141 (gap1)
Enzymes [BR:nmg01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     Nmag_2141 (gap1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C DapB_N Gp_dh_N NAD_binding_3 2-Hacid_dh_C TrkA_N Semialdhyde_dhC GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: ADD05710
UniProt: D3SW49
Position
complement(2186585..2187598)
Genome map
AA seq 337 aa AA seqDB search
MIQVAINGYGTIGKRVADAVRAQPDMEVLGVAKTRPNFEAETAIEKGFALYAAIEEREHL
FDEAGLDIAGSVDELVADADIVVDATPSGIGAENKSLYEEYETPALYQGGEDADLVDVSF
NARSNFEDATDADHVRVVSCNTTGLSRVIAPLRETYGVEKVRATLVRRGGDPGQTDRGPI
NDILPNPVTIPSHHGPDVETIFDDLDIDTLGMKVPATQMHMHSLNVTLEEEVDAADVRDL
FADESRLFLIPEHMAIDGSGKLKEYALDAGRPRGDVWENAIWEESISTVGRDLYLFQGIH
QESDVVPENIDAVRAVLGTADAEESIETTDETLGIGL
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgatccaggtcgcgatcaacggctacggaacgatcggcaaacgcgtcgcagacgccgtc
cgggcccagcccgacatggaagttctcggcgtcgcgaagacgcggccgaacttcgaggcc
gagaccgctatcgagaagggattcgccctctacgccgccatcgaggaacgcgagcacctg
ttcgacgaggccggactcgacatcgccggctccgtcgacgagctcgtcgccgacgcggat
atcgtcgtcgacgctacgccctccggcatcggcgctgagaacaaatcgctgtacgaggag
tacgagacgcccgcactctaccagggtggcgaggacgccgacctggtcgacgtgagcttc
aacgcgcgctcgaatttcgaggacgccaccgacgccgatcacgtccgcgtcgtctcctgt
aacacgaccggactctcccgcgtcatcgcaccgcttcgcgagacctacggcgtcgagaag
gtccgcgccacgctcgtccgccgcggcggcgatccaggtcagaccgaccgtggaccgatc
aacgatatcctcccgaacccggtgacgattccgtcccaccacggccccgacgtcgagacc
atcttcgatgacctcgacatcgacacgctcgggatgaaggtcccggcgacgcagatgcac
atgcacagcctcaacgtcacactcgaggaggaagtcgacgcggccgacgttcgcgacctg
ttcgccgacgagtcgcgactgttcctgatccccgaacacatggctatcgacggcagcggg
aagctgaaggagtacgccctcgatgcgggccggccacgcggcgacgtctgggagaacgcc
atctgggaggagtccatctcgaccgtgggtcgcgacctctacctcttccagggaatccac
caggagagcgacgtggtgccggagaacatcgacgcggttcgtgcggtactcggcacagcc
gacgccgaggagagcatcgagacgaccgacgagacgctcggcatcgggctctga

DBGET integrated database retrieval system