KEGG   Natrialba magadii: Nmag_2584Help
Entry
Nmag_2584         CDS       T01176                                 

Definition
(GenBank) putative oxidoreductase (short-chain dehydrogenase family)
  KO
K00019  3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
nmg  Natrialba magadii
Pathway
nmg00072  Synthesis and degradation of ketone bodies
nmg00650  Butanoate metabolism
nmg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nmg00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Nmag_2584
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Nmag_2584
Enzymes [BR:nmg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     Nmag_2584
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short adh_short_C2 3HCDH_N Polysacc_synt_2 OCC1 Methyltransf_25 Epimerase
Motif
Other DBs
NCBI-ProteinID: ADD06143
UniProt: D3SYH2
Position
complement(2656917..2657774)
Genome map
AA seq 285 aa AA seqDB search
MSQQQVAPPSVTRSDIHTIDDDSFTARNVCLVTGAGSGIGRATALAAAGNGLTVAATDID
EDALAETVARRNELDLQGEIEQIVGDLTVDDDIEQIVETAASHGDIKYLANVAGMQHIDA
IENFPMDAYDRMHRVMVRAPLYLSKLCLPHFRDTASGDGCVGNMASVHGHYVTSDKVGYN
ISKFGLRGLTQSIAAEGAGDVRSFSISTGYVQTPLVMDQLEDTAEQRGISVDEVIQDVML
GQSRVTEMMAPIDVGNLFVLGFSELGRHLDGGDLLFDGGMTLTYE
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgtcacagcaacaggtcgcgccaccgtcggtaacgcgctcggatatccatacgatcgac
gacgactcgttcactgcacggaacgtctgtctcgttaccggagcgggctctgggatcggt
cgtgcaaccgcactcgccgccgccggaaacgggttgaccgtcgcggcgacagatatcgac
gaggacgcactcgcggaaacggtcgcccgacgcaacgaactcgatctgcagggtgaaatc
gagcaaatcgtcggtgacctcacggtcgacgacgacatcgaacaaatcgtcgagacggcc
gcaagccacggtgacatcaagtacctcgcgaacgtcgccggaatgcaacacattgatgcg
atcgaaaacttcccgatggatgcctacgatcgcatgcatcgggtgatggttcgagcaccg
ctgtatctctcgaaactgtgtcttcctcacttccgtgacactgcgagcggtgatggctgt
gtggggaacatggcatcggtccacggccactacgtcacgagcgacaaggtcgggtacaac
atctcgaaattcgggctacgcggcctcacacagtcgatagcggctgaaggtgcaggcgac
gttcgctcgttctcgatcagcaccgggtacgtccagacgccgctcgtgatggaccaactc
gaggacacggccgagcagcggggcatctcggtcgacgaggtgattcaggacgtgatgctc
ggccagtcccgcgtcacagagatgatggcgccaatcgacgtcggcaatctctttgtgctc
ggcttttccgaactgggccggcatctggacggcggcgacctgttgtttgatgggggcatg
acgctaacgtacgagtga

DBGET integrated database retrieval system