KEGG   Neisseria meningitidis H44/76 (serogroup B): NMBH4476_0030Help
Entry
NMBH4476_0030     CDS       T01946                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
nmh  Neisseria meningitidis H44/76 (serogroup B)
Pathway
nmh00450  Selenocompound metabolism
nmh00970  Aminoacyl-tRNA biosynthesis
nmh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nmh00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    NMBH4476_0030
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    NMBH4476_0030
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:nmh01007]
    NMBH4476_0030
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:nmh03016]
    NMBH4476_0030
Enzymes [BR:nmh01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     NMBH4476_0030
Amino acid related enzymes [BR:nmh01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   NMBH4476_0030
Transfer RNA biogenesis [BR:nmh03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    NMBH4476_0030
 Prokaryotic type
   Other AARSs
    NMBH4476_0030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 Anticodon_1 tRNA-synt_1f tRNA-synt_1e Ribosomal_60s DALR_1
Motif
Other DBs
NCBI-ProteinID: ADY94718
Position
complement(25631..27688)
Genome map
AA seq 685 aa AA seqDB search
MTRKILVTSALPYANGSIHLGHMVEHIQTDVWVRFQKLRGHACHYCCADDTHGTPVMLAA
QKQGIAPEDMIAKVREEHLADFTGFFIGYDNYYSTHSPENKQFSQDIYRALKANGKIESR
VIEQLFDPEKQMFLPDRFVKGECPKCHAQDQYGDNCEVCGTTYSPTELINPYSAVSGTKP
ELRESEHFFFKLGECADFLKAWTSGNNPHDGKPHLQAEALNKMKEWLGEGEETTLSDWDI
SRDAPYFGFEIPDAPGKYFYVWLDAPVGYMASFKNLCDRIGVDFDEYFKADSQTEMYHFI
GKDILYFHALFWPAMLHFSGHRAPTGVYAHGFLTVDGQKMSKSRGTFITAKSYLEQGLNP
EWMRYYIAAKLNSKIEDIDLNLQDFISRVNSDLVGKYVNIAARASGFIAKRFEGRLKDVA
DSELLAKLTAQSEAIAECYESREYAKALRDIMALADIVNEYVDANKPWELAKQEGQDERL
HEVCSELINAFTMLTAYLAPVLPQTAANAAKFLNLEAITWANTRDTLGKHAINKYEHLMQ
RVEQKQVDDLIEANKQSIAAAAAPAAEEGKYEKVAEQASFDDFMKIDMRVAKVLNCEAVE
GSTKLLKFDLDFGFEKRIIFSGIAASYPNPAELNGRMVIAVANFAPRKMAKFGVSEGMIL
SAATADGKLKLLDVDTGAQPGDKVG
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atgacacgcaaaatcttagttacctccgccctgccctatgccaacggcagcatccacctc
ggccacatggtcgaacacatccaaaccgacgtttgggtgcgctttcaaaaactgcgcggc
cacgcgtgccactactgctgcgccgacgacacccacggcacgcccgtaatgcttgccgcg
caaaaacaaggtatcgcgcccgaagacatgattgccaaagtgcgcgaagagcacctcgcc
gactttactggctttttcatcggttacgacaattattacagcacccattcccctgaaaac
aaacagttttcccaagacatttaccgcgcgctgaaagccaacggcaagattgagagccgc
gtcatcgagcagcttttcgaccccgaaaaacaaatgttcctgcccgaccgcttcgtcaaa
ggcgaatgcccgaaatgccacgcccaagaccaatacggcgacaactgcgaagtctgcggc
acgacctattccccgaccgaactgattaacccgtattccgccgtttccggtacgaaaccc
gaattgcgcgaatccgaacacttcttcttcaaactgggcgaatgcgccgacttcctcaaa
gcatggacttccggcaacaacccgcacgacggcaagccccatctgcaagccgaagccctc
aacaaaatgaaagaatggctgggcgaaggtgaagaaaccaccctgtccgactgggatatt
tcccgcgacgcgccgtatttcggttttgaaatccccgacgcgccgggcaaatacttctac
gtctggctggacgcgcccgtcggctacatggcgtcgtttaaaaacctgtgcgaccgcatc
ggcgtcgattttgacgaatacttcaaagccgacagccaaaccgagatgtaccacttcatc
ggcaaagatattctctatttccacgccctgttctggcccgctatgctgcatttctccggc
caccgcgccccgaccggcgtgtacgcacacggctttttgaccgtcgacggacaaaaaatg
tccaaatcgcgcggcacgtttattaccgccaaatcctatctggaacaaggcctgaacccc
gagtggatgcgctactacatcgccgccaaactcaacagcaaaatcgaagacatcgatttg
aacctgcaagactttatcagccgcgtaaacagcgacctcgtcggcaaatacgtcaacatc
gccgcccgcgcctcaggtttcatcgccaaacgctttgaaggccgtctgaaagatgttgcc
gacagcgaattgctggcaaaactgactgcgcaaagcgaagccattgccgaatgctacgaa
agccgcgaatacgccaaagccctgcgcgacatcatggccttggcagacattgtcaacgaa
tacgttgatgccaacaagccgtgggaactcgccaaacaagaaggccaagacgaacgcctg
cacgaagtatgcagcgaactcatcaacgccttcaccatgttgaccgcctacctcgccccc
gtcttgccgcaaaccgccgcaaacgccgccaaattcctgaatttggaagccatcacttgg
gcaaatacacgcgataccttgggcaaacacgccatcaacaaatacgaacatttaatgcaa
cgagtggagcaaaaacaagtggacgatttaatcgaagccaacaaacaaagcatcgccgcc
gcagccgcacctgccgccgaagagggcaaatacgaaaaagtcgccgaacaggcgagtttc
gacgactttatgaaaatcgacatgcgcgttgccaaagtattgaactgcgaagctgtcgaa
ggcagcaccaaacttttgaaattcgacctcgatttcggttttgaaaaacgcatcatcttc
tccggcatcgccgcgtcttacccgaaccctgccgaattgaacggccgcatggtcatcgcc
gtcgccaacttcgccccgcgcaaaatggcaaaattcggtgtatctgaaggcatgattttg
agtgccgccacggcagacgggaaactgaagctcttggatgtggatacaggcgcgcagccg
ggcgacaaagtcggttaa

DBGET integrated database retrieval system