KEGG   Neisseria meningitidis H44/76 (serogroup B): NMBH4476_0144Help
Entry
NMBH4476_0144     CDS       T01946                                 

Gene name
rplV
Definition
(GenBank) ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
nmh  Neisseria meningitidis H44/76 (serogroup B)
Pathway
nmh03010  Ribosome
Brite
KEGG Orthology (KO) [BR:nmh00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    NMBH4476_0144 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:nmh03011]
    NMBH4476_0144 (rplV)
Ribosome [BR:nmh03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    NMBH4476_0144 (rplV)
  Bacteria
    NMBH4476_0144 (rplV)
  Archaea
    NMBH4476_0144 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: ADY94815
Position
154554..154883
Genome map
AA seq 109 aa AA seqDB search
MRVNAQHKNARISAQKARLVADLIRGKDVAQALNILAFSPKKGAELIKKVLESAIANAEH
NNGADIDELKVVTIFVDKGPSLKRFQARAKGRGNRIEKQTCHINVTVGN
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atgagagtaaatgcacaacataaaaatgcccgtatctctgctcaaaaggctcgtttggta
gctgatttgattcgtggtaaagacgttgcccaagctttgaatattttggctttcagtcct
aaaaaaggtgccgagctgattaaaaaagtattggagtcagctattgctaatgccgagcac
aataacggtgcggacattgatgaactgaaagtggtaactatctttgttgacaaaggccca
agcttgaaacgttttcaagctcgcgccaaaggtcgcggtaaccgcatcgaaaaacaaact
tgtcatatcaatgtgacagtgggtaactaa

DBGET integrated database retrieval system