KEGG   Neisseria meningitidis H44/76 (serogroup B): NMBH4476_0375Help
Entry
NMBH4476_0375     CDS       T01946                                 

Gene name
hemN
Definition
(GenBank) oxygen-independent coproporphyrinogen III oxidase
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
nmh  Neisseria meningitidis H44/76 (serogroup B)
Pathway
nmh00860  Porphyrin and chlorophyll metabolism
nmh01100  Metabolic pathways
nmh01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nmh00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    NMBH4476_0375 (hemN)
Enzymes [BR:nmh01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     NMBH4476_0375 (hemN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM HemN_C
Motif
Other DBs
NCBI-ProteinID: ADY95027
UniProt: E6MX14
Position
complement(382692..384113)
Genome map
AA seq 473 aa AA seqDB search
MKIIQIQNNHNVNDDRPEFDRALIASLPASGPRYTSYPTADRFHDGFREGEYIKALHLRG
MGALNKPLSLYIHIPFCNTICYYCGCNKIITKDKSRADAYIEYLEKEMELLAPHLNGRHQ
LAQLHFGGGTPTFLSDEQIERVFRMIRKHFELIPTGEYSIEIDPRKVSRDTVLMLGRLGF
NRMSIGIQDFDPKVQAAVNRIQSYEETKEVIDAAREAGFKSVSVDLIYGLPHQTSESIKT
TIDTVLSLDPDRLALYHYAHLPHVFKPQRRIDTAAVPDSEEKLDMLQYCVQTLTERGYVF
IGMDHFAKPDDELSIALKEGFLQRNFQGYSTYADCDLVAIGVSSIGKIGSTYSQNERDID
AYYAAIDEGRLPIMRGYQLNQDDILRRNIIQDLMCRFALDYRIYESMFGIPFDRYFKDEL
ADLEKLAGLGLVRLNSHGLTVTPKGRFLIRNIAMVFDYHLRHKETKAKYSQTV
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcattcagatacagaacaatcacaatgtaaacgatgaccgccccgagtttgac
cgcgcgctgattgccagcctgcccgccagcggcccgcgctacacttcctaccctaccgcc
gaccgtttccatgacggtttccgcgaaggcgaatatatcaaagctttacatttgcgcggt
atgggcgcgttaaacaaaccgctttccctttacattcacattccgttctgcaacaccatc
tgctactactgcggctgcaacaaaatcatcaccaaagacaaaagccgcgccgatgcctac
atcgaatatcttgaaaaagaaatggaactgctcgctccacatctgaacggacggcaccag
cttgcccaactgcacttcggcggcggcacgccgacctttttgagcgacgaacagatcgaa
cgtgtcttccgcatgatacgcaaacatttcgagttaatccccaccggcgaatactccatc
gaaatcgacccgcgcaaagtcagccgcgacaccgtcctcatgctcggcagactcggcttc
aaccgcatgagcatcggcattcaggatttcgaccccaaagtgcaggcggcggtcaaccgc
atccaaagttacgaagaaaccaaagaagtcatcgatgcggcgcgcgaagcggggttcaaa
tccgtcagcgtcgatttgatttacggcctgccgcaccagacttcggaaagcatcaaaacc
accatcgataccgttttgtcgctcgatcccgaccgcctcgccctttatcactacgcccac
ctgccgcacgtgttcaaaccgcaacgccgcatcgataccgccgccgttcccgacagcgaa
gagaagctcgatatgctgcaatactgcgtccaaaccctaaccgaacgcggctacgtcttc
atcggcatggatcatttcgccaaacctgacgacgaactctccatcgccctcaaagaaggc
ttcctccagcgcaacttccaaggctattcgacctacgcggattgcgatttggtcgccatc
ggcgtgtcgtccatcggcaaaatcggcagcacctattcccaaaacgaacgcgacatcgat
gcctactatgccgccatcgacgaaggcagactgcccatcatgcgcggctaccagctcaat
caggacgacatcctgcgccgcaacatcattcaggatttgatgtgccgtttcgcgctcgac
tatcggatttacgaaagtatgttcggcatcccgttcgaccgctacttcaaagacgaactg
gcggatttggaaaaactcgccggtttgggattggtgcgcctgaacagccacgggctgacc
gttaccccgaaaggacgcttcctcatccgcaacatcgccatggtcttcgattaccacctg
cgccataaagaaaccaaggcgaaatattcgcaaacagtgtga

DBGET integrated database retrieval system