KEGG   Neisseria meningitidis H44/76 (serogroup B): NMBH4476_0861Help
Entry
NMBH4476_0861     CDS       T01946                                 

Gene name
gatB
Definition
(GenBank) aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
nmh  Neisseria meningitidis H44/76 (serogroup B)
Pathway
nmh00970  Aminoacyl-tRNA biosynthesis
nmh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nmh00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    NMBH4476_0861 (gatB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:nmh03029]
    NMBH4476_0861 (gatB)
Enzymes [BR:nmh01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     NMBH4476_0861 (gatB)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     NMBH4476_0861 (gatB)
Mitochondrial biogenesis [BR:nmh03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    NMBH4476_0861 (gatB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey YqeY DUF3580 HTH_Tnp_Mu_2
Motif
Other DBs
NCBI-ProteinID: ADY95477
UniProt: E6MZC1
Position
complement(949461..950891)
Genome map
AA seq 476 aa AA seqDB search
MTWETVIGLEIHVQLNTKSKIFSGASTAFGAEPNAHASVVECALPGVLPVMNREVVEKAI
KLGLALDAKINQKNVFDRKNYFYPDLPKGYQISQLDLPIVEHGKLEIVVGDDVKTINVTR
AHMEEDAGKSVHEGLNGATGIDLNRAGTPLLEVVSEPEMRSAAEAVAYAKALHSLVTWLD
ICDGNMAEGSFRVDANVSVRPKGQEEFGTRREIKNLNSFRFLEQAINYEAEAQIEILEDG
GKVQQATMLFDPEKGETRVMRLKEDAHDYRYFPDPDLLPVIISDAQMQKAKAEMPELPKE
MAARFVADYGVSEYDARLLTASRAQAAYFEEAAKESGQGKLTANWMNGELAAALNKEGME
LADSPITAPRLAALVGKIADGTLSSKLAKKAFEAMWAEPEATIAEIIEKHGLQQMTDTGE
IEAMVDEVLANNAKAVEQFKSGNEKALNAIVGQVMKASKGKANPAQVQELIKAKLA
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgacctgggaaaccgtaatcggcttggaaatccacgtccaattgaacaccaaatccaaa
atcttcagcggcgcatcgaccgcattcggcgcagaacccaacgcgcacgccagcgtagtg
gaatgcgcgctgccgggcgttttgcctgtgatgaaccgtgaagtcgttgaaaaagccatc
aaattgggtttggctttagatgcgaaaatcaatcagaaaaacgtgttcgaccgcaaaaac
tacttctatcccgacttaccaaaaggttatcaaatcagccagttggacttaccgattgtc
gaacacggcaaattggaaatcgtagtcggcgacgatgtgaaaaccatcaacgtaacccgt
gcgcacatggaagaagacgcaggcaagtccgtgcatgaaggcttgaacggcgcaaccggt
atcgacctgaaccgcgccggcacgccgctgttggaagtggtatccgaacctgaaatgcgt
tccgccgccgaagccgttgcctacgccaaggccttgcacagcttggtaacctggctggac
atttgcgacggcaatatggcggaaggctcgttccgcgtcgatgccaacgtatccgtgcgc
ccgaaaggtcaagaagagttcggcacgcgccgcgagattaaaaacctcaattccttccgt
ttcttggagcaggcgattaattacgaagcggaagcgcaaatcgagattttggaagacggc
ggcaaagtacagcaggcaaccatgctgtttgatcccgaaaaaggcgaaacccgcgtaatg
cgcctgaaagaagatgcgcacgactaccgctacttccccgaccctgatttgctgcccgtt
atcatttcagacgcccaaatgcaaaaagccaaagcagaaatgcccgagctgccgaaagaa
atggcagcgcgtttcgtggcggattacggcgtgtccgaatacgacgcgcgcctgctgacc
gcaagccgtgcgcaggctgcctattttgaagaagccgccaaagaaagcggacaaggcaag
ctgactgccaactggatgaacggcgaacttgccgccgcgctgaacaaagaaggcatggaa
cttgccgacagcccgattaccgccccgcgcctcgccgcgctggttggcaaaatcgccgac
ggcacattaagcagcaagttagcgaaaaaagcctttgaagccatgtgggcagaacccgaa
gccaccattgccgaaatcattgaaaaacacggtttgcaacagatgaccgacaccggcgag
attgaagccatggtggacgaagtgctggcaaacaacgccaaagccgtggaacagtttaaa
tccggcaacgaaaaagccctgaatgcgattgtgggacaagtgatgaaggccagcaaaggc
aaagccaaccccgcgcaggttcaagagctgattaaagccaaactggcttaa

DBGET integrated database retrieval system