KEGG   Neisseria meningitidis H44/76 (serogroup B): NMBH4476_0907Help
Entry
NMBH4476_0907     CDS       T01946                                 

Definition
(GenBank) nucleoside-diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
nmh  Neisseria meningitidis H44/76 (serogroup B)
Pathway
nmh00230  Purine metabolism
nmh00240  Pyrimidine metabolism
nmh01100  Metabolic pathways
nmh01110  Biosynthesis of secondary metabolites
Module
nmh_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
nmh_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
nmh_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:nmh00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    NMBH4476_0907
   00240 Pyrimidine metabolism
    NMBH4476_0907
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:nmh04131]
    NMBH4476_0907
Enzymes [BR:nmh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     NMBH4476_0907
Membrane trafficking [BR:nmh04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    NMBH4476_0907
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: ADY95522
UniProt: E6MZ62
Position
complement(1006169..1006594)
Genome map
AA seq 141 aa AA seqDB search
MAIERTISIIKPDAVGKNVIGKIYSRFEENGLKIVAAKMKQLTLKEAQEFYAVHKDRPFY
AGLVEFMTGGPVMIQVLEGENAVLKNRELMGATNPSEAAEGTIRADFATSVSINAVHGSD
SVENAALEIAYFFSQTEICPR
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atggcgattgaacgtaccatctccatcatcaaacccgatgccgtcggcaaaaatgttatc
ggcaaaatatacagccgctttgaggagaacggtctgaaaatcgttgccgccaaaatgaag
cagcttactctcaaagaggcgcaagaattttatgcggttcataaagaccgccccttctac
gccggattggttgaatttatgaccggcggtccggttatgattcaggtattagagggtgaa
aacgccgtcctgaaaaaccgcgaactgatgggtgcaactaatccttccgaagccgccgaa
ggcacgatacgcgcggactttgccacttcggtcagcattaatgccgtacacggttccgac
agcgtggaaaatgccgctttggaaattgcctactttttcagccaaaccgaaatctgcccc
cgttga

DBGET integrated database retrieval system