KEGG   Neisseria meningitidis H44/76 (serogroup B): NMBH4476_0910Help
Entry
NMBH4476_0910     CDS       T01946                                 

Definition
(GenBank) S-(hydroxymethyl)glutathione dehydrogenase
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
nmh  Neisseria meningitidis H44/76 (serogroup B)
Pathway
nmh00010  Glycolysis / Gluconeogenesis
nmh00071  Fatty acid degradation
nmh00350  Tyrosine metabolism
nmh00625  Chloroalkane and chloroalkene degradation
nmh00626  Naphthalene degradation
nmh00680  Methane metabolism
nmh01100  Metabolic pathways
nmh01110  Biosynthesis of secondary metabolites
nmh01120  Microbial metabolism in diverse environments
nmh01130  Biosynthesis of antibiotics
nmh01200  Carbon metabolism
nmh01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:nmh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NMBH4476_0910
  09102 Energy metabolism
   00680 Methane metabolism
    NMBH4476_0910
  09103 Lipid metabolism
   00071 Fatty acid degradation
    NMBH4476_0910
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    NMBH4476_0910
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    NMBH4476_0910
   00626 Naphthalene degradation
    NMBH4476_0910
Enzymes [BR:nmh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     NMBH4476_0910
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     NMBH4476_0910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 TrkA_N MinC_C 2-Hacid_dh_C Met_10
Motif
Other DBs
NCBI-ProteinID: ADY95525
Position
complement(1009031..1010161)
Genome map
AA seq 376 aa AA seqDB search
MKQADSTIKSRAAVAFAPNQPLQIVEIDVEMPRKGEVLIRNTHTGVCHTDAFTLSGSDPE
GVFPVVLGHEGAGVVVAVGEGVSSVKPGDHVIPLYTAECGECEFCCSGKTNLCVSVRDTQ
GKGLMPDGTTRFSYQGQPIYHYMGCSTFSEYSVVAEVSLAKINPEANHEQVCLLGCGVTT
GIGAVHNTAKVQEGDSVAVFGLGAIGLAVVQGARQAKAGRIIAIDTNPSKFELAKQFGAT
DCLNPNDYDKPIKDVLLDINKWGIDHTFECIGNVNVMRQALESAHRGWGQSIIIGVAGAG
QEISTRPFQLVTGRVWKGSAFGGVKGRSELPKMVEDSMKGDIELEPFVTHTMTLDQINKA
FDLMHEGKSIRAVIHY
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaagccgattcaaccatcaaatctcgtgcggcggtggcattcgcccctaaccaa
cccttacaaattgtggaaatcgacgtagaaatgccgcgtaaaggcgaggtgttaatccgc
aatacccacactggcgtgtgccatactgatgcgtttacgttatcaggaagcgatcctgaa
ggcgtattccctgtggtgcttggacacgaaggtgcgggtgtggtcgttgctgtgggcgaa
ggtgtgtcaagcgtaaaaccgggtgatcacgtgattccgctttacaccgccgaatgtggc
gaatgtgagttttgttgttcaggtaaaaccaacttgtgcgtctcagtgcgtgatacacaa
ggtaaaggcttaatgccggacggcacgacgcgtttttcttatcaaggtcagccaatctat
cactatatgggctgttcgactttcagtgaatactccgttgttgccgaagtttcactggcg
aaaatcaaccctgaagccaaccatgaacaagtatgtttgctcggctgcggcgttaccaca
ggtattggtgcggtacataatacggcaaaagtgcaagaaggcgactctgttgccgtgttt
ggtttgggggcgattggtttggcggtggtgcaaggtgcgcgtcaagccaaagccggccgc
attatcgccattgataccaatccatcaaaatttgagttggcaaaacagttcggtgcaacg
gattgtttgaacccgaacgattacgataaaccgatcaaagatgtgttgttagacattaat
aaatggggcattgaccatacctttgaatgtatcggcaatgtaaacgtaatgcgtcaggca
ttagaaagtgcacatcgtggttggggtcaatccattatcatcggcgtagcaggtgcagga
caagaaatttcaacgcgtccgttccagttggtaacaggtcgtgtttggaaaggttcagca
tttggcggtgtgaaaggtcgctctgaactgccgaaaatggtggaagattcaatgaaaggc
gacattgagttagaaccgtttgtaacccacacaatgacactcgatcaaatcaataaagcc
tttgacttaatgcacgaaggtaaatcgatccgcgccgttattcactactaa

DBGET integrated database retrieval system