KEGG   Neisseria meningitidis H44/76 (serogroup B): NMBH4476_0958Help
Entry
NMBH4476_0958     CDS       T01946                                 

Definition
(GenBank) GTP cyclohydrolase II
  KO
K01497  GTP cyclohydrolase II [EC:3.5.4.25]
Organism
nmh  Neisseria meningitidis H44/76 (serogroup B)
Pathway
nmh00740  Riboflavin metabolism
nmh00790  Folate biosynthesis
nmh01100  Metabolic pathways
nmh01110  Biosynthesis of secondary metabolites
nmh02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:nmh00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    NMBH4476_0958
   00790 Folate biosynthesis
    NMBH4476_0958
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    NMBH4476_0958
Enzymes [BR:nmh01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     NMBH4476_0958
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydro2
Motif
Other DBs
NCBI-ProteinID: ADY95570
Position
complement(1069606..1070178)
Genome map
AA seq 190 aa AA seqDB search
MASCRLPTEWGVFTMHGFEEANGQEHVALTVGNFSDGNPVLTRIHSECLTGDALFSRKCD
CGPQLEAAMRAVQTEGRGIIVYLRQEGRGIGLINKIRAYHLQDQGMDTVEANLALGLPVD
ARDFRLAQSIYEYLGIRSVKLLTNNPEKIQTLKDAGINVVERIPLHVGENLENKRYLQTK
ADKLGHLMSE
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
gtggcatcctgccgcctgccgaccgaatggggcgtatttacgatgcacggctttgaagag
gcaaacgggcaggaacacgtcgcgctgaccgtcggtaatttttcagacggcaatccggtt
ctgacgcgcatccactccgaatgcctgacgggcgatgcgctgttctcgagaaaatgcgac
tgcggacctcaacttgaagcggccatgagggcggtacagacagaggggcgcggcatcatc
gtctatctgcgtcaggaaggacgcggcatcgggctgattaacaaaatccgcgcctatcat
ctgcaagaccaaggtatggatacggttgaagccaatttggcactcgggctgcccgtcgat
gcccgcgatttccgtttggcgcaatctatctacgaatatctgggcatccgctcggtcaaa
ctgctgaccaacaaccccgaaaaaatccaaaccctgaaagatgcggggattaacgtggtc
gaacgcatccccctgcacgtcggggaaaaccttgaaaacaaacgctacctccaaaccaaa
gcagacaagctgggacatctgatgtcggaataa

DBGET integrated database retrieval system