KEGG   Neisseria meningitidis H44/76 (serogroup B): NMBH4476_1217Help
Entry
NMBH4476_1217     CDS       T01946                                 

Gene name
sucB
Definition
(GenBank) dihydrolipoyllysine-residue succinyltransferase, E2 component of oxoglutarate dehydrogenase succinyl-transferring complex
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
nmh  Neisseria meningitidis H44/76 (serogroup B)
Pathway
nmh00020  Citrate cycle (TCA cycle)
nmh00310  Lysine degradation
nmh00380  Tryptophan metabolism
nmh01100  Metabolic pathways
nmh01110  Biosynthesis of secondary metabolites
nmh01120  Microbial metabolism in diverse environments
nmh01130  Biosynthesis of antibiotics
nmh01200  Carbon metabolism
Module
nmh_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nmh_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:nmh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NMBH4476_1217 (sucB)
  09105 Amino acid metabolism
   00310 Lysine degradation
    NMBH4476_1217 (sucB)
   00380 Tryptophan metabolism
    NMBH4476_1217 (sucB)
Enzymes [BR:nmh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     NMBH4476_1217 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 Neisseria_TspB
Motif
Other DBs
NCBI-ProteinID: ADY95815
UniProt: E6MVY2
Position
complement(1327926..1329107)
Genome map
AA seq 393 aa AA seqDB search
MIIDVKVPMLSESVSEGTLLEWKKKVGEAVARDEILIDIETDKVVLEVPSPQAGVLVEIV
AQDGETVVADQVLARVDTAATAAAEAPAAAPAEAAPAAAPAATQNNAAMPAAAKLAAETG
VDVNALQGSGRDGRVLKEDVQNAAAKPAGAAAPAVALPAGARPEERVPMSRLRARVAERL
LASQQENAILTTFNEVNMKPIMDLRAKYKEKFEKEHGVKLGFMSFFVKAAVAALKKYPVV
NASVDGKDIVYHGYFDIGIAIGSPRGLVVPILRDADQMSIADIEQAIVDYAKKAKDGKIA
IEDLTGGTFSITNGGTFGSMMSTPIINPPQSAILGMHATKERAVVENGQVVVRPMMYLAL
SYDHRIIDGREAVLTLVAIKDALEDPARLLLDL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgattattgatgtaaaagtacctatgttgtctgaaagcgtatctgaaggcacgctcttg
gaatggaagaaaaaagttggcgaagccgttgcccgtgacgaaatcctgatcgatatcgaa
acggacaaagtggttttggaagtaccttctccacaagccggcgtattggttgaaatcgta
gctcaagacggtgaaaccgttgttgccgaccaagttttggcgcgcgtcgatacagctgct
actgccgctgctgaagccccagccgccgctcctgcagaagctgccccagctgccgctcct
gctgctacacaaaacaacgccgctatgcctgctgccgccaaactggctgccgagaccggt
gttgacgtgaacgcattgcaaggttccggccgtgacggtcgcgtattgaaagaagacgta
caaaatgccgctgccaaacctgccggagccgctgctcctgctgttgcacttcctgccggc
gcacgtcctgaagaacgcgtaccaatgagccgcctgcgtgcccgtgttgcagaacgcctc
ttggcttctcaacaagaaaacgccattctgactacattcaacgaagtcaacatgaaacca
atcatggacttgcgtgcgaagtacaaagaaaaattcgagaaagaacacggcgtgaaactg
ggctttatgtccttcttcgttaaagccgctgttgccgccctgaaaaaatacccggttgtg
aatgcttctgttgacggcaaagacatcgtgtaccacggctacttcgacatcggtatcgca
attggcagcccacgcggtttggttgtgccaattctgcgtgatgccgaccaaatgagcatt
gccgacatcgaacaagcaattgttgattacgcgaaaaaagccaaagacggcaaaatcgct
atcgaagatctgaccggcggtacattcagtattaccaacggcggtactttcggttctatg
atgtctaccccgatcatcaacccacctcaatctgcgattttgggtatgcacgccactaaa
gagcgcgctgtggttgaaaacggccaagttgttgtccgtccgatgatgtatctggctctg
tcttacgaccaccgtatcattgacggccgcgaagctgtattgaccttggtagccattaaa
gacgcgttggaagacccggcccgcctgttgttggatctgtaa

DBGET integrated database retrieval system