KEGG   Neisseria meningitidis H44/76 (serogroup B): NMBH4476_1826Help
Entry
NMBH4476_1826     CDS       T01946                                 

Definition
(GenBank) putative protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
nmh  Neisseria meningitidis H44/76 (serogroup B)
Brite
Enzymes [BR:nmh01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     NMBH4476_1826
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_25 Methyltransf_31 RrnaAD CMAS Methyltransf_11 Methyltransf_18 Methyltransf_12 Ubie_methyltran Methyltransf_23 Methyltr_RsmB-F Methyltransf_9 MTS Methyltransf_3 Methyltransf_24 Methyltransf_4 Aconitase_2_N DUF938
Motif
Other DBs
NCBI-ProteinID: ADY96395
UniProt: E6MV39
Position
complement(1958875..1959531)
Genome map
AA seq 218 aa AA seqDB search
MDFEKARFNMVEQQIRPWDVLDFDVLDALAEIPRELFVDEDLQGLAYADMALPLANGHKM
LEPKVVARLAQGLKLTKNDTVLEIGTGSGYATALLAKLAGRVVSDDIDVEQQNRAKAVLD
GLGLDNIDYVQNNGLTELSAGAPFDAVYVGGAVNLVPEVLKEQLKDGGRMVVIVGRKPVQ
RALLITRRGDVFEEKVLFDTLVAHLDDKDADPFGGFDF
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atggattttgaaaaagcgcggttcaatatggtcgaacagcaaatccgtccgtgggatgta
ttggattttgatgtgttggacgctttggcggagattccgcgcgagctttttgtcgatgag
gacttgcagggtttggcgtatgcggatatggcgctgccgcttgccaacggtcataagatg
ctcgagccgaaagtcgtggcgcggctggcgcagggcttgaagctgacgaaaaacgatacg
gttttggaaatcggcacgggttcgggctatgcgaccgcgctgttggcaaaattggctggt
cgtgtggtgtcggacgacatcgatgtcgaacagcaaaaccgcgccaaagcggtgttggac
ggcttgggtttggacaatatcgattatgtgcaaaacaacgggttgaccgaactttccgca
ggtgcgccgtttgatgcggtttatgtcggcggtgcggtaaaccttgtgcctgaagtgttg
aaagaacagttgaaagatggcggacgcatggtggttatcgtaggtcgcaagcctgttcaa
cgcgcgcttttgattacgcgcaggggcgatgtgtttgaagagaaggtgctgttcgatacc
ttggtggcgcatttggatgataaggatgccgatccgtttggcggtttcgatttttaa

DBGET integrated database retrieval system