KEGG   Neisseria meningitidis alpha14 (cnl strain): NMO_0071Help
Entry
NMO_0071          CDS       T00954                                 

Gene name
mqo
Definition
(GenBank) malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
nmi  Neisseria meningitidis alpha14 (cnl strain)
Pathway
nmi00020  Citrate cycle (TCA cycle)
nmi00620  Pyruvate metabolism
nmi01100  Metabolic pathways
nmi01110  Biosynthesis of secondary metabolites
nmi01120  Microbial metabolism in diverse environments
nmi01130  Biosynthesis of antibiotics
nmi01200  Carbon metabolism
Module
nmi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nmi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:nmi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NMO_0071 (mqo)
   00620 Pyruvate metabolism
    NMO_0071 (mqo)
Enzymes [BR:nmi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     NMO_0071 (mqo)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO Pyr_redox_2 MCRA PRRSV_Env
Motif
Other DBs
NCBI-ProteinID: CBA03435
UniProt: C6S4I0
Position
64869..66335
Genome map
AA seq 488 aa AA seqDB search
MAEATDVVLVGGGIMSATLGVLLKELEPSWEITLIERLEDVALESSNAWNNAGTGHSALC
ELNYAPLGADGIINPARALNIAEQFHISRQFWATLVAEGKLEDNSFVNAVPHMSLVMNED
HCRYLQKRYDVFKTQKLFENMEFSTDRNKISDWAPLIMRGRDENQPVAANYSAEGTDVDF
GQLTRQMVKYLQGKGVKTEFNRHVEDIKRESDGAWVLKTADTRNPDGQLTLRTRFLFLGA
GGGALTLLQKSGIPEGKGYGGFPVSGLFFRNSNPETAEQHNAKVYGQASVGAPPMSVPHL
DTRNVDGKRHLMFGPYAGFRSNFLKQGSLMDLPLSIHMDNLYPMLRAGWANMPLTKYLLG
ELRKTKEERFASLLEYYPEANPDDWELITAGQRVQIIKKDSEKGGVLQFGTEIVAHADGS
LAALLGASPGASTAVPLMIRLMHQCFPKRAPSWEGRLKELVPGYGIKLNENPERADEIIA
YTAKVLDI
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagcgacagacgttgtcttggtgggcggcggcattatgagcgcgactttgggc
gttttgctcaaagaactcgaaccgtcttgggaaatcaccctgattgaacgcttggaagat
gtggcgttggaatcgtcaaacgcgtggaacaacgccggcacggggcattccgcactgtgc
gaattgaactatgcgccgctgggtgcggacggcatcatcaatccggcacgcgccctcaat
attgccgaacagttccacatcagccgccagttttgggcgacgctggtcgcggaaggcaag
ttggaagacaattctttcgtcaatgccgtgccgcatatgtctttggtgatgaacgaagac
cactgccgttacctgcaaaaacgctatgatgtgtttaaaacgcagaaactttttgaaaat
atggaattctccaccgatcggaacaagatttccgattgggctccgctgataatgcgcggc
cgggacgaaaaccaacccgtcgccgccaactattccgccgaaggcacggatgtcgatttc
ggacagctgacgcgccagatggtgaaatatttgcagggcaagggcgtaaaaaccgagttc
aaccgccacgtcgaagacatcaaacgcgaatccgacggcgcgtgggtgctcaaaaccgcc
gatacccgcaaccccgacgggcagctcaccctccgtacccgcttcctcttcctcggcgcg
ggcggcggcgcgctgaccctgctgcaaaaatccggcatccccgaaggcaagggctacggc
ggcttccccgtgtccggcctgttcttccgcaacagcaaccccgaaactgccgaacaacac
aacgccaaagtgtacgggcaggcttccgtcggcgcgccgccgatgtccgtcccgcacctc
gacacacgcaacgtggacggcaaacgccaccttatgttcggcccttacgcaggcttccgt
tccaacttcctcaagcaaggctcgcttatggatttgccgctgtccatccatatggacaac
ctctatcctatgctgcgcgccggctgggcgaatatgccgctgaccaaatacctgctgggc
gaattgcgtaaaaccaaagaagaacgcttcgcctccctgctggaatactaccccgaggca
aaccccgacgactgggaactcatcaccgcagggcaacgcgtccaaatcattaaaaaagac
tccgaaaaaggcggcgtgctccagtttggtacggagattgtcgcccacgccgacggctcg
ctcgccgcattgctgggcgcgtcgccgggcgcatcgaccgctgtgccgctgatgatccgg
ctgatgcaccaatgcttccccaagcgcgccccgtcgtgggaaggccgtctgaaagagctg
gtaccgggttacggcatcaagttgaacgaaaaccctgaaagggcggatgaaattatcgcc
tataccgcgaaagtattggatatttaa

DBGET integrated database retrieval system