KEGG   Neisseria meningitidis alpha14 (cnl strain): NMO_0201Help
Entry
NMO_0201          CDS       T00954                                 

Gene name
aldA
Definition
(GenBank) aldehyde dehydrogenase A
  KO
K07248  lactaldehyde dehydrogenase / glycolaldehyde dehydrogenase [EC:1.2.1.22 1.2.1.21]
Organism
nmi  Neisseria meningitidis alpha14 (cnl strain)
Pathway
nmi00620  Pyruvate metabolism
nmi00630  Glyoxylate and dicarboxylate metabolism
nmi01100  Metabolic pathways
nmi01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:nmi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    NMO_0201 (aldA)
   00630 Glyoxylate and dicarboxylate metabolism
    NMO_0201 (aldA)
Enzymes [BR:nmi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.21  glycolaldehyde dehydrogenase
     NMO_0201 (aldA)
    1.2.1.22  lactaldehyde dehydrogenase
     NMO_0201 (aldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh MecA
Motif
Other DBs
NCBI-ProteinID: CBA03685
UniProt: C6S4V4
Position
complement(221934..223376)
Genome map
AA seq 480 aa AA seqDB search
MKQLAMYINGRFENDFNGEWRDVLNPSTEEAIAREPKGGRADVDRAVAAARAAQPAWERL
PAVERGAYLRKIAQGIRERADELTDTIVAEGGKTKDLARVEVMFTADYLDYQAEWARRYE
GEIIQSDRPRENILLFKRPLGVIAGILPWNFPFFLIARKMGPALVTGNTIVVKPSSVTPI
NCHIFAEIVDAVGLPAGVFNVVNGPGAEIGNALSAHPQVDMVSLTGSVEAGRQVMEAASA
NITKVSLELGGKAPAIVLKDADLDLAVKSILASRVGNTGQICNCAERVYVHSSLKDAFIE
KMTAAMKGVRYGNPAEAEAGALEMGPLIEERAVKAVAEKVERAVKQGAKLVCGGKRAEGR
GYFFEPTLLTDTDNSMDIMKEETFGPVLPVSAFDTLDQVIALANDCEFGLTSSVYTTNLN
EAFYVTRRLQFGETYINRENFEAMQGFHAGWKKSGIGGADGKHGLEEYLQTQVVYLETDI
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaattggccatgtacatcaacggacgctttgaaaacgatttcaacggcgaatgg
cgcgacgtattgaacccgtccaccgaagaggccatcgcccgcgaacccaaaggcggcagg
gcggacgttgaccgcgccgtagcggcggcgcgtgcggcgcaaccggcttgggagcgtctg
cctgcggtcgaacgcggcgcgtatttgcgcaaaatcgcccaaggcatacgcgaacgcgcc
gacgagctgaccgacaccatcgttgccgaaggcggcaaaaccaaagacttggcgcgcgtg
gaagtcatgtttaccgccgactatctcgattaccaagccgaatgggcgcgtcgttacgaa
ggcgaaatcatccaaagcgaccgcccgcgcgaaaatattttattgttcaaacgtccgctg
ggcgtaatcgccggcattttgccgtggaacttccccttcttcctgattgcccgcaaaatg
ggccccgctttggtaacgggcaacaccatcgtcgtcaaacccagcagcgtaaccccgatc
aactgccacatcttcgccgaaatcgtcgatgcggtcggactgccagcaggcgtgttcaac
gttgtgaacggtccgggtgcggaaatcggcaatgccttgtccgcccatccgcaagtcgat
atggtcagcctgaccggctccgttgaagcgggccgccaagtgatggaagccgcttctgcc
aacatcaccaaagtctcgctggaactcggcggcaaagcacctgctatcgttttgaaagac
gcggatttggacttggcagtgaaatccatcttggcttcgcgcgtcggcaacactggtcaa
atctgcaactgcgccgagcgcgtttatgtccacagcagtctgaaagacgcgtttatcgaa
aaaatgaccgccgccatgaaaggcgtacgctacggcaaccctgccgaagccgaagcaggc
gcgctggaaatgggcccgctgattgaagagcgcgccgtcaaagccgttgccgaaaaagtg
gaacgggcagtcaaacaaggtgcgaaattggtttgcggcggcaaacgcgccgaaggacgc
ggttatttcttcgagcctaccctgctgaccgacaccgacaacagtatggacattatgaaa
gaagaaaccttcggccccgtgctgcccgtttccgctttcgacacgctcgaccaggtcatc
gccttggcaaatgactgcgaattcggtctgaccagctctgtgtacaccaccaacctgaac
gaagccttctacgttacccgccgcctgcaattcggcgaaacctacatcaaccgcgaaaac
tttgaagcgatgcagggtttccacgccggttggaaaaaatccggtatcggcggcgcggac
ggcaaacacggtttggaagaatatctgcaaacccaagtcgtttatttggaaaccgacatt
taa

DBGET integrated database retrieval system