KEGG   Neisseria meningitidis alpha14 (cnl strain): NMO_0428Help
Entry
NMO_0428          CDS       T00954                                 

Gene name
adhA
Definition
(GenBank) alcohol dehydrogenase, zinc-containing
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
nmi  Neisseria meningitidis alpha14 (cnl strain)
Pathway
nmi00010  Glycolysis / Gluconeogenesis
nmi00071  Fatty acid degradation
nmi00350  Tyrosine metabolism
nmi00625  Chloroalkane and chloroalkene degradation
nmi00626  Naphthalene degradation
nmi01100  Metabolic pathways
nmi01110  Biosynthesis of secondary metabolites
nmi01120  Microbial metabolism in diverse environments
nmi01130  Biosynthesis of antibiotics
nmi01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:nmi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NMO_0428 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    NMO_0428 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    NMO_0428 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    NMO_0428 (adhA)
   00626 Naphthalene degradation
    NMO_0428 (adhA)
Enzymes [BR:nmi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     NMO_0428 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 CoA_binding Methyltransf_25 TrkA_N DUF2237 Methyltransf_31
Motif
Other DBs
NCBI-ProteinID: CBA04253
UniProt: C6S5G7
Position
complement(465519..466565)
Genome map
AA seq 348 aa AA seqDB search
MKMQAVVVNKNVAGDVEIVEREVRPLEYGEALVEVEYCGVCHTDLHVAAGDYGEKPGRVL
GHEGIGLVKEVADGVKNLKVGDRVSIAWLFQSCGSCEYCNTGRETLCRSVLNAGYTADGG
MATYCIVSADYAVKVPEGLDPAQASSITCAGVTTYKAIKVSSVRPGQWIAIYGAGGLGNL
GVQYAKKVFGAHVVAIDINDDKLAFAKETGADLVVNAAKEDAAKVIQEKTGGAHAAVVTA
VSAAAFNSAVNCVRAGGRVVAIGLPPESMDLSIPRLVLDGIEVVGSLVGTRKDLEEAFQF
GAEGLVVPKVQLRALDEAPAIFQEMREGKITGRMVIDMKKECGCGHHH
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatgcaggcagttgttgtgaataaaaatgtagcgggcgatgtggaaatagtcgaa
cgcgaggttcgcccgttggaatacggcgaggcgttggtcgaagtcgaatattgcggcgtg
tgccacaccgacctgcacgttgcggcaggcgactacggcgaaaaaccgggccgcgtgctg
ggacacgagggcatcggtttggttaaagaagttgccgacggtgtgaaaaatctgaaagtc
ggcgaccgcgtcagcatcgcctggctgttccaaagctgcggctcgtgcgaatactgcaat
accggccgcgaaaccttgtgccgctctgtattgaacgcgggctacaccgccgacggcggt
atggcgacctactgcatcgtgagtgccgattacgcggtcaaagtccctgaaggtttggat
cctgcgcaagcttccagcattacttgtgccggtgtaaccacttataaagccattaaagtt
tccagtgttcgtccgggacagtggattgccatctacggcgcgggcggtttgggcaacttg
ggggtccaatacgcgaaaaaagtatttggcgcacacgttgtcgccatcgacatcaacgac
gacaaactggcgtttgccaaagaaaccggcgcggatttggttgtcaacgccgccaaagaa
gacgctgccaaagtgattcaggaaaaaaccggcggcgcacacgctgcggtcgtaaccgcc
gtatctgctgccgcattcaactctgccgtgaattgcgtccgcgcaggcggacgtgtggtt
gccatcgggctgccgccggaatcgatggatttgtccatcccgcgtttggttttggacggc
atcgaagtggtcggctctttggtcggcacgcgcaaagatttggaagaagccttccaattc
ggcgcggaaggtttggttgtgccgaaagtccaactgcgtgctttggatgaagcacccgcc
attttccaagaaatgcgcgaaggcaaaatcaccggccgtatggtaatcgatatgaaaaaa
gaatgcggctgcggccatcaccactga

DBGET integrated database retrieval system