KEGG   Neisseria meningitidis alpha14 (cnl strain): NMO_0678Help
Entry
NMO_0678          CDS       T00954                                 

Gene name
pgm
Definition
(GenBank) Phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
nmi  Neisseria meningitidis alpha14 (cnl strain)
Pathway
nmi00010  Glycolysis / Gluconeogenesis
nmi00030  Pentose phosphate pathway
nmi00051  Fructose and mannose metabolism
nmi00052  Galactose metabolism
nmi00230  Purine metabolism
nmi00500  Starch and sucrose metabolism
nmi00520  Amino sugar and nucleotide sugar metabolism
nmi00521  Streptomycin biosynthesis
nmi01100  Metabolic pathways
nmi01110  Biosynthesis of secondary metabolites
nmi01120  Microbial metabolism in diverse environments
nmi01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:nmi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NMO_0678 (pgm)
   00030 Pentose phosphate pathway
    NMO_0678 (pgm)
   00051 Fructose and mannose metabolism
    NMO_0678 (pgm)
   00052 Galactose metabolism
    NMO_0678 (pgm)
   00500 Starch and sucrose metabolism
    NMO_0678 (pgm)
   00520 Amino sugar and nucleotide sugar metabolism
    NMO_0678 (pgm)
  Nucleotide metabolism
   00230 Purine metabolism
    NMO_0678 (pgm)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    NMO_0678 (pgm)
Enzymes [BR:nmi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     NMO_0678 (pgm)
    5.4.2.8  phosphomannomutase
     NMO_0678 (pgm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: CBA04970
UniProt: C6S655
Position
complement(727749..729131)
Genome map
AA seq 460 aa AA seqDB search
MASIARDIFKAYDIRGIVGKTLTDEAAYLIGKAIAAKAAEKGMTRIALGRDGRLSGPELM
EHIQRGFTDSGIDVLNVGMVATPMLYFAAINECGGSGVMITGSHNPPDYNGFKMMLGGDT
LAGEAIQELLSIIEKDGFAAAGKQGSVTEKDISGEYHNHIVGHVKLKRPMNIAIDAGNGV
GGAFAGKLYRALRCGVTELFCDVDGNFPNHHPDPSKPKNLQDLIAALKNGDAEIGLAFDG
DADRLGVVTKDGNIIYPDRQLMLFAQDVLSRNPGAKVIFDVKSTRLLAPWIKEHGGEAIM
EKTGHSFIKSTMKKTGALVAGEMSGHIFFKERWFGFDDGLYAGARLLEILSASDNPSEVL
NNLPQSISTPELNIALPEGSNGHQVIDELAAKAEFEGATEIITIDGLRVEFPDGFGLMRA
SNTTPILVLRFEADTQEAIERIQNQFKAVIESNPNLIWPL
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atggcaagcatcgcccgcgacatcttcaaagcctacgacatccggggtattgtcggcaaa
accctgaccgacgaagccgcctaccttatcggcaaagccatcgccgccaaagccgccgaa
aaaggcatgacccgcatcgcgctcggacgcgacggacgcttgagcggtcccgaactgatg
gagcacatccaacgcggctttaccgacagcggcatcgacgtcctcaacgtcggtatggtc
gccacgcccatgctctattttgccgctatcaacgaatgcggcggcagcggcgtgatgatt
accggcagccacaatccgcccgattacaatggtttcaaaatgatgctcggcggcgacacg
cttgccggcgaagccatccaagagcttttgtccatcattgaaaaagacggttttgctgcc
gccggcaaacaaggcagcgtaaccgaaaaagacatctccggcgaataccacaaccacatc
gtcggacacgtcaaactcaaacgcccgatgaacatcgctatcgacgcgggcaacggcgtg
ggcggcgcatttgcaggcaaactctaccgcgctttgaggtgcggcgttaccgaacttttc
tgcgacgtggacggcaatttccccaaccaccatcccgacccatccaaacccaaaaacctg
caagatttgattgccgcgctgaaaaacggcgatgccgaaatcggcttggcgtttgacggc
gatgccgaccgcttgggcgtggttaccaaagacggcaacattatttatcccgaccgccaa
ctgatgctgttcgcgcaagacgtgttgagccgcaaccccggcgcgaaagtcatcttcgac
gtgaagtccacccgcctgcttgccccgtggattaaagaacacggcggcgaagccataatg
gaaaaaaccggccacagcttcatcaaatcgaccatgaaaaaaaccggcgcactcgtcgcc
ggcgaaatgagcggacacatcttcttcaaagaacgctggttcggcttcgacgacggcctg
tacgccggcgcacgcctcttggaaatcctgtccgcctccgataatccgtccgaagtgtta
aacaacctgccgcaaagcatttccacgcccgaactcaacatcgccctgcccgaaggcagc
aacggccatcaggttatcgacgaactcgccgccaaagccgaatttgaaggcgcaaccgaa
atcatcaccatcgacggtctgcgcgttgaatttcccgacggcttcggtctgatgcgtgct
tccaataccacgccgattctggtgttgcgttttgaggcggatacgcaagaagccatcgag
cggattcaaaaccaattcaaagccgtcatcgaaagcaatccgaatctaatctggcctctg
taa

DBGET integrated database retrieval system