KEGG   Neisseria mucosa ATCC 19696: NM96_00530Help
Entry
NM96_00530        CDS       T05436                                 

Definition
(GenBank) carbon-nitrogen hydrolase family protein
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
nmj  Neisseria mucosa ATCC 19696
Brite
KEGG Orthology (KO) [BR:nmj00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    NM96_00530
Enzymes [BR:nmj01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     NM96_00530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: AVR80216
UniProt: A0A2R4AYS0
Position
101681..102559
Genome map
AA seq 292 aa AA seqDB search
MQKNIRAAAVQMISSTDPDANIDTMKCLVRQAAEQGADWVLLPEYWPLMGCKDTDKLAFA
EPLVGSNFSETCHTGFGETRCARFGETRYARFQTTLSETAAECGVVLFGGTIPLQSPDAG
KVMNTMLVYDRDGTQIGLYHKMHLFGFSGLGERYAEADTISAGGDVPKLAADGVPLAAGV
CYDLRFPEFFRAQQPFDVLLLPAAFTYTTGKAHWELLLRARAVENQCYVIASAQGGEHES
GRRTFGHSMIIDPWGEILDVLPEGEGIVIADLDAARLQSVRTRLPALKHRLL
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaaaacatccgcgcagccgccgtacaaatgatttcgtccaccgatcccgatgcc
aatatcgacaccatgaaatgcctcgttcgccaagctgccgagcaaggcgcggattgggtg
ctgttgcccgaatattggccgctgatggggtgcaaggatactgacaaactggcttttgcc
gaacctttagtcggtagtaattttagcgaaacctgccacactggttttggcgaaacccgc
tgcgctcgttttggcgaaactcgctacgctcgttttcagacgaccttgagcgagacggcg
gcggaatgcggcgtggtgctgttcggcggcacgattccgctgcaaagccccgatgcgggc
aaagtgatgaacactatgttggtgtacgaccgcgacggcacgcaaatcgggctgtatcac
aaaatgcacctgttcggtttttcaggcttgggcgaacgctatgccgaggcggacaccatc
agcgcaggcggcgatgtgccgaaattggctgccgacggcgtgccgcttgccgcgggcgtg
tgctacgacttgcgctttcccgagttttttcgcgcccagcagccgtttgacgttttgctg
ctgcccgccgccttcacttacacgacaggcaaagcgcattgggaattgctgctgcgcgcc
cgcgcggtggaaaaccaatgctacgtcatcgcctcggcgcaaggcggcgaacacgaaagc
ggcaggcgcacgttcggtcatagcatgattatcgacccgtggggcgaaatcttggacgta
ttgcccgaaggcgagggcatcgtcatcgccgatttggacgctgcgaggctgcaaagtgta
cgcaccagactgcccgctttgaagcacaggttgttgtga

DBGET integrated database retrieval system