KEGG   Neisseria mucosa: NM96_01040Help
Entry
NM96_01040        CDS       T05436                                 

Definition
(GenBank) PHP domain-containing protein
  KO
K07053  3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97]
Organism
nmj  Neisseria mucosa
Brite
KEGG Orthology (KO) [BR:nmj00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    NM96_01040
Enzymes [BR:nmj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.97  3',5'-nucleoside bisphosphate phosphatase
     NM96_01040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHP
Motif
Other DBs
NCBI-ProteinID: AVR78134
UniProt: A0A2R4ASX0
Position
complement(198021..198857)
Genome map
AA seq 278 aa AA seqDB search
MIDLHCHSTVSDGMLSPTEVVRLAHQNGCTLLALTDHDHTGGIAEARAEADKLGLRFVNG
VEISVTWRGRTIHVVGLDFDEQDENLQNLLAQVRQGRLKRLEAIAAKLEKKGIGGAYDGA
LALAANKEMVSRTHIAEFLIQAGHVKNKQQAFTKYLGDGKSCAVRHEWATLADCVSAVNG
AGGMAIIAHPMRYDLSATVKRNLFEEFKNLGGVGIEVHSGNCCKNDRLNYALLAERFGML
ASAGSDFHRLNDFSGGILGACPELPENCKPVWEHFKRV
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgatagacctgcattgccattccaccgtttccgacggtatgctctcccctaccgaagtc
gtgcgccttgcgcatcaaaacggctgcacgctgctggcgttgaccgaccacgaccacacc
ggcggcattgccgaagcacgtgccgaagccgacaagctcgggctgcgtttcgtcaacggc
gtggaaatctccgtaacttggcgcgggcgcaccatacacgtcgtcggtttggatttcgac
gaacaggacgaaaacctgcaaaacctgttggcacaagtgcggcaaggtcgtctgaaacgc
cttgaagccatcgccgccaagctcgaaaagaaaggcatcggcggcgcatacgacggtgcg
ctcgcgctggcagcaaacaaagaaatggtcagccgcacccacatcgccgagttcctcatc
caagcgggacacgtcaaaaacaagcagcaggcgttcaccaaatacttgggcgacggcaaa
tcctgcgccgtccgtcacgaatgggcgacgctggcagactgcgtctccgccgtcaacggc
gcaggcggcatggctatcatcgcccaccccatgcgctacgacttgtccgccaccgtcaag
cgcaatctgtttgaagaatttaaaaacctcggcggcgtgggcatcgaagtccacagcggc
aactgctgcaaaaacgaccgcctcaactacgcgctgctggcagaacgcttcggtatgctc
gccagcgcgggcagcgatttccaccgcttaaacgacttcagtggcggcatcctcggcgcg
tgtcccgaactgccggaaaactgcaaaccggtttgggaacatttcaaaagggtttga

DBGET integrated database retrieval system