KEGG   Neisseria mucosa: NM96_11085Help
Entry
NM96_11085        CDS       T05436                                 

Definition
(GenBank) tRNA pseudouridine(65) synthase TruC
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
nmj  Neisseria mucosa
Brite
KEGG Orthology (KO) [BR:nmj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:nmj03016]
    NM96_11085
Enzymes [BR:nmj01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     NM96_11085
Transfer RNA biogenesis [BR:nmj03016]
 Prokaryotic Type
  tRNA modification factors
   Psudouridine synthases
    NM96_11085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 Plasmid_stab_B PH_12
Motif
Other DBs
NCBI-ProteinID: AVR80330
UniProt: A0A2R4AZ45
Position
complement(2198380..2199087)
Genome map
AA seq 235 aa AA seqDB search
MLDILYRDSRTIAVNKPAGMLVHRSWLDRHETQFVMQTLRDQIGQHVYPAHRLDRPTSGV
LLFALDPEAARLLTQQFEQKTTCKTYWAIVRGYLPDDGLIDYPLKYQPDKIAESQTEATL
QEAQTRYRCLARTELPFQSAARYPTSRYSWAELIPHTGRKHQLRRHMKHIFHPIVGDTNY
GDLRQNHATAAHLGTTRLMLHARSLSFQSIENGETLTVCADTDESWRIWLDAFKA
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacatcctctaccgcgacagccgcaccatcgccgtcaacaaacccgccggaatg
ctcgtccaccgaagctggctcgaccgccacgaaacacagttcgtcatgcaaaccctgcgc
gaccaaatcggacaacacgtctatcccgcccaccgcctcgaccgccccacatccggcgtc
ctcctgtttgccctcgaccccgaagccgcccgcctgctgacgcagcagttcgaacaaaaa
accacatgcaaaacctattgggcaatcgtgcgcggatatttgcccgacgacggactcatc
gactaccccctcaaatatcagcccgacaaaatcgccgaatcccaaaccgaagccaccctc
caagaagcccaaacccgataccgctgccttgcgcgcaccgaattgcccttccaatccgcc
gcccgctacccgacctcgcgctactcatgggcagaactcatcccgcacacaggccgcaaa
caccaactgcgccgccacatgaaacacatcttccaccccatcgtcggcgacaccaactac
ggcgacctgcgccaaaaccacgccaccgccgcccatctcggcaccacccgcctcatgctc
cacgcccgcagcctctcattccaaagcatcgaaaacggcgaaaccctgaccgtctgcgcc
gataccgacgagagctggcggatttggctggatgcgtttaaagcgtaa

DBGET integrated database retrieval system