KEGG   Neisseria mucosa ATCC 19696: NM96_11700Help
Entry
NM96_11700        CDS       T05436                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
nmj  Neisseria mucosa ATCC 19696
Pathway
nmj00450  Selenocompound metabolism
nmj00970  Aminoacyl-tRNA biosynthesis
nmj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nmj00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    NM96_11700
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    NM96_11700
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:nmj01007]
    NM96_11700
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:nmj03016]
    NM96_11700
Enzymes [BR:nmj01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     NM96_11700
Amino acid related enzymes [BR:nmj01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   NM96_11700
Transfer RNA biogenesis [BR:nmj03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    NM96_11700
 Prokaryotic type
   Other AARSs
    NM96_11700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1f tRNA-synt_1e Anticodon_1 Thioredoxin_4
Motif
Other DBs
NCBI-ProteinID: AVR79898
UniProt: A0A2R4AXZ1
Position
complement(2313927..2315984)
Genome map
AA seq 685 aa AA seqDB search
MTRKILVTSALPYANGSIHLGHMVEHIQTDVWVRFQKLRGHECHYCCADDTHGTPVMLAA
QKQGIAPEDMIAKVREEHLADFTGFFIGYDNYYSTHSPENKQFSQDIYRALKANGKIESR
VIEQLFDPEKQMFLPDRFVKGECPKCHAQDQYGDNCEVCGTTYSPTELINPYSAVSGAKP
ELRESEHFFFKLGECADFLKAWTSGNNPHDGKPHLQPEALNKMKEWLGEGEETTLSDWDI
SRDAPYFGFEIPDAPGKYFYVWLDAPVGYMASFKNLCDRIGVDFDEYFKADSQTEMYHFI
GKDILYFHALFWPAMLHFSGHRAPTGVYAHGFLTVDGQKMSKSRGTFITAKSYLEQGLNP
EWMRYYIAAKLNSKIEDIDLNLQDFISRVNSDLVGKYVNIAARASGFIAKRFEGRLKDVS
GSALLAKLAAESDNIAEQYENREYARALRDIMALADAVNEYVDANKPWELAKQEGQDERL
HEVCSELINAFTMLTAYLAPVLPQTAANAARFLNLDAITWANTRETLGEHAINKYEHLMQ
RVEQKQVDDLIEANKQSIQTTPAPAAEDSKYEKVAEQASFDDFMKIDMRVAKVLNCEAVE
GSTKLLKFDLDFGFEKRIIFSGIAASYPNPAELNGRMVIAVANFAPRKMAKFGVSEGMIL
SAATAEGKLKLLDVDAGAQPGDKVG
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atgacacgcaaaatcctcgttacctccgcgctgccctatgccaacggcagcattcacctc
ggccacatggtcgaacacatccaaaccgacgtttgggtgcgctttcaaaaactgcgcggc
cacgaatgccactactgctgcgccgacgatacccacggtacgcccgtgatgcttgccgcg
caaaaacaaggcattgcgcccgaagacatgattgccaaagtgcgtgaagagcacctcgcc
gacttcaccggctttttcatcggctacgacaattattacagcacccattcccctgaaaac
aaacagttttcccaagacatttaccgcgcgctgaaagccaacggcaagattgagagccgc
gtcatcgagcagcttttcgaccccgaaaaacaaatgttcctgcccgaccgcttcgtcaaa
ggcgaatgccccaaatgccacgcccaagaccaatacggcgacaactgcgaagtctgcggc
acgacctattccccgaccgaactgattaacccgtattccgccgtttccggtgccaaaccc
gaattgcgcgaatccgaacacttcttcttcaaactgggcgaatgcgccgacttcctcaaa
gcatggacttccggcaacaacccgcacgacggcaagccccatctacaacccgaagccctc
aacaaaatgaaagaatggctgggcgaaggcgaagaaaccaccctgtccgactgggacatt
tcccgcgacgcgccgtatttcggtttcgaaatccccgacgcgccgggcaaatacttctac
gtctggctggacgcgcccgtcggctacatggcgtcgtttaaaaacctgtgcgaccgcatc
ggcgtcgattttgacgaatacttcaaagccgacagccaaaccgagatgtaccatttcatc
ggcaaagacatcctctatttccacgccctgttctggcccgccatgctgcatttctccggc
caccgcgccccgaccggcgtgtacgcacacggctttttgaccgtggacggacaaaaaatg
tccaaatcgcgcggcacgtttatcaccgccaaatcctatctggaacaaggcctgaacccc
gagtggatgcgctactacatcgccgccaaactcaacagcaaaatcgaagacatcgatttg
aacctgcaagactttatctcgcgcgtcaacagcgacctcgtcggcaaatacgtcaacatc
gccgcccgcgcgtcaggtttcatcgccaaacgctttgaaggtcgtctgaaagacgtttca
ggcagcgcattgctggcaaaactcgccgccgaaagcgacaacatagccgagcaatacgaa
aaccgcgaatacgcccgcgccctgcgcgacatcatggcattggcagatgccgtgaacgaa
tacgtcgatgccaacaaaccgtgggaactcgccaaacaggaaggtcaagacgaacgcctg
cacgaagtatgcagcgaactcatcaacgccttcaccatgctgaccgcctacctcgccccc
gtgttgccgcaaactgccgccaacgccgcgcgtttcctcaatctggacgcgattacctgg
gcgaacacgcgcgaaaccctaggcgaacacgccatcaacaaatacgaacatttaatgcaa
cgagtggagcaaaaacaagtggacgatttaatcgaagccaacaaacaaagcattcagacg
acccccgcgcctgccgccgaagacagcaaatacgaaaaagtcgccgagcaggcaagcttc
gacgacttcatgaaaatcgacatgcgcgtcgccaaagtattgaactgcgaagccgtcgaa
ggaagcaccaaactcttaaaattcgacctcgatttcggttttgaaaaacgcatcatcttc
tccggcatcgccgcatcttatcccaaccccgccgaattgaacggccgcatggtcatcgcc
gtcgccaacttcgccccgcgcaaaatggcaaaattcggcgtatccgaaggcatgattctc
tccgccgccaccgccgagggcaaactgaagctcttggatgtcgatgcaggcgcgcagccc
ggggataaagtgggctaa

DBGET integrated database retrieval system