KEGG   Neisseria mucosa ATCC 19696: NM96_13360Help
Entry
NM96_13360        CDS       T05436                                 

Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
nmj  Neisseria mucosa ATCC 19696
Pathway
nmj00430  Taurine and hypotaurine metabolism
nmj00620  Pyruvate metabolism
nmj00640  Propanoate metabolism
nmj00680  Methane metabolism
nmj01100  Metabolic pathways
nmj01120  Microbial metabolism in diverse environments
nmj01200  Carbon metabolism
Module
nmj_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:nmj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    NM96_13360
   00640 Propanoate metabolism
    NM96_13360
  09102 Energy metabolism
   00680 Methane metabolism
    NM96_13360
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    NM96_13360
Enzymes [BR:nmj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     NM96_13360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase FAD_binding_4 ROK
Motif
Other DBs
NCBI-ProteinID: AVR80162
UniProt: A0A2R4AYS6
Position
2640586..2641797
Genome map
AA seq 403 aa AA seqDB search
MSDQLILVLNCGSSSLKGAVIDRKSGSVVLSCLGERLGTPEAVITFSKDGNKRQVPLTGR
NCHAGAVGMLLNELEKHGLHDRIKAIGHRIAHGGEKYHESVLIDQDVLDELKACIPLAPL
HNPANISGILAAQEHFPGLPNVGVMDTSFHQTMPERAYTYAVPRELRKKHAFRRYGFHGT
SMRYVAPEAARILGKPLEDLRMIVAHLGNGASITAIRNGKSVDTSMGFTPIEGLVMGTRC
GDIDPGVYSYLTAHAGMNIEQVDEMLNKKSGLLGISELSNDCRTLEIAADEGHEGARLAL
EVMTYRLAKYIASMSVACGGIDALVFTGGIGENSRNIRAKTVAYLDYLGLHIDTKANMEK
RYGNSGIISPTGSNPAVLVVPTNEELMIALDTAELAGFLQEAG
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaccaactcatcctcgtcctgaactgcggcagttcctcgctcaaaggtgccgtt
atcgaccgcaaaagcggcagcgtcgtcctaagctgcctcggcgaacgtttgggtacgccc
gaagccgtcatcaccttcagcaaagacggcaacaaacgccaagttcccctgaccggccgc
aactgccacgccggcgcggtgggtatgctgttgaacgaactggaaaaacacggcctgcac
gaccgcatcaaagccatcggccaccgtatcgcccacggcggcgaaaaatatcacgagtcc
gtcctcatcgaccaagacgtcctcgacgaactgaaagcctgcatcccgctcgccccgctg
cacaaccccgccaacatcagcggcatcctcgccgcgcaggaacacttccccggcctgccc
aacgtcggcgtgatggacacctcgttccaccaaaccatgcccgaacgcgcctatacctac
gccgtaccgcgcgaattgcgcaaaaaacacgccttccgccgctacggcttccacggcacc
agcatgcgctacgtcgcccccgaagccgcgcggattttgggcaaaccgctggaagatttg
cgcatgatcgtcgcccacctcggcaacggcgcgtccatcaccgccatccgaaacggcaaa
tccgtcgataccagcatgggcttcacccccattgaaggcctcgtcatgggtacccgctgc
ggcgacatcgaccccggcgtgtacagctacctgaccgcccacgccggcatgaacatcgag
caagtcgatgaaatgctgaacaaaaaatcaggattgctcggcatctccgaactctccaac
gactgccgcaccctcgaaatcgccgccgacgaaggccacgaaggcgcacgtctcgccctc
gaagtcatgacctaccgcctcgccaaatacatcgcctcgatgtcggttgcctgcggcggc
atagacgccctcgtcttcaccggcggcatcggcgaaaactcccgcaacatccgcgccaaa
accgtcgcctacctcgactatttgggtttgcacatcgacaccaaagccaatatggaaaaa
cgctacggcaactcaggtatcatcagcccgacaggttccaatcccgccgttttggtcgta
ccgactaacgaagaactgatgatcgcactcgacaccgccgaactggcaggcttcttacaa
gaagcaggctag

DBGET integrated database retrieval system