KEGG   Neobacillus mesonae: CHR53_12915
Entry
CHR53_12915       CDS       T06691                                 

Definition
(GenBank) oxidoreductase
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
nmk  Neobacillus mesonae
Pathway
nmk00230  Purine metabolism
nmk01100  Metabolic pathways
nmk01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:nmk00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    CHR53_12915
Enzymes [BR:nmk01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     CHR53_12915
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C DUF1522
Other DBs
NCBI-ProteinID: AZU64957
UniProt: A0A3Q9QWM6
Position
complement(2641102..2643453)
AA seq 783 aa
MNNEIQVKEKTTSGEENSTDFKWIGKPVKRIDGEPKVTGELKYMTDIHYDNMLWGKILRA
KYPYAKIKGIDTSKAEALEGVVAVLTHKDVPGFNGFGIIIPDQPVLAEDIVRCTGDAVAL
VAAETKEMAEMALGLIEVNYEPLEPVTDPEYAMSKEAAHLHPSGNIHSHVAIRNGDVEKA
FAEADLVLENTFYSPRQMHAFIETEGGWGVLGENGILTIQCPGQYAHRDKLQIARALGYN
PDLIHVISSPLGGAFGGKDEITVQIYLALLALHSNGRPVKIHLSREESVVAGIKRHPFKV
HVKTAAMKDGTLVAQQVRAVADTGAYASLGGAVIALAIEHATGPYKIPNIDLEGFCVYTN
NGISGAFRGFGVNQVCVGIETHLDMIARYFHLDPIEIRQKNAYKQGEYSSLGHLVKSSVG
THKTLEAAKNCELWVNQDLYKSKPSEPWKKRGIGVATSFHGIGMGIGVPDYGAASIELLA
DGYFKVGVGCEEIGGGNSTVYAQAAAELLKCEINKIKVVQGNTKETPDGGTVTASRSTYA
GTRAIASAAPNMNKLLTQTAADMFDVPVHEITHLNGLLYVKMRPELSLTHAEIYEYLFEN
RLNTKVEGHFILPKEKGEIKNSGGAPHHIYGYLTHVVLVEIDTLTGETDVLRVVSIPDAG
RVINPQGLEGQTEGGAIMGIGYTLYEDVIIENGIHKTKNFTDYIIPTIRETPIIETIPVE
EPEPSNPLGAKGIGEVVMIPIIPAIMNALYDAVGIRIKHLPATPERIFKEMKFLKEKVHP
QTR
NT seq 2352 nt   +upstreamnt  +downstreamnt
atgaataatgagattcaagtaaaagaaaaaacaacgtccggagaagaaaattccactgat
tttaaatggattggtaaacctgtgaaacggattgatggcgaacctaaagttacaggtgaa
ctaaaatacatgacagacattcattatgacaatatgctttggggcaagatcctccgcgcg
aaatatccttatgcaaaaataaaaggaattgatacatcaaaggcagaggctttagaaggt
gttgtagcggtcttaacacataaggatgttccagggtttaatggttttggcattatcatt
cctgaccaaccggttcttgctgaagatattgttcgctgcactggggacgcagtcgcactt
gttgctgcggaaacaaaagaaatggctgagatggcacttggattaatcgaagtgaattat
gaaccactggaacctgtaacagatccggaatatgctatgtcaaaggaagctgcccacctt
cacccaagcgggaacattcacagtcatgtggcaataagaaatggagatgtcgaaaaagct
tttgcagaagcggatttggtattagaaaatacgttttactcccctagacagatgcatgct
ttcattgaaacagaaggcggctggggagtccttggtgaaaatggtattttaacaatccaa
tgccccggacaatatgcacaccgcgataaactgcaaattgcacgggcacttggctataac
ccagatctaattcatgttatttctagtccgcttggtggtgcctttggcggaaaggacgaa
ataacagtccaaatttatttagcccttttagctctacattcaaatggacgccccgtaaaa
attcaccttagccgagaggaatcagttgttgccgggattaagcgccacccttttaaagta
catgttaaaacagcagcaatgaaggatggcacattggttgctcaacaagtgagggcggtt
gccgatactggggcatatgcatcactaggcggtgctgtcattgcgcttgcaatagaacac
gcaacaggtccatataaaattcccaacattgatttagaaggcttttgtgtctataccaat
aacggaatctccggagcctttagaggatttggggtgaaccaggtttgtgttggaattgag
acccatcttgatatgattgccaggtattttcatctggatccaatcgaaattagacagaaa
aatgcctacaaacaaggtgaatattcaagccttggtcatctagttaaatcaagtgttggt
acacataaaacactagaagcggcaaaaaattgcgaactttgggtaaaccaggacttatat
aaaagtaaaccaagtgagccgtggaaaaaacgtgggatcggtgttgctacctcctttcac
ggtatcggcatgggaattggcgtccctgactatggtgctgcttccatagaacttttagca
gatggctattttaaagttggggtcggctgtgaggaaatcggcggcggcaatagtaccgtg
tatgctcaggctgcagccgagcttcttaaatgtgagataaataaaataaaagttgtccaa
ggaaatactaaggaaacacccgatggcggtacagttacagcctcccgttcgacctatgca
ggcacaagggcaattgcttcagctgcgccgaatatgaataagctgctcacacaaacggca
gcggatatgtttgacgttccagttcatgagatcactcatttaaatggtctgttatatgtt
aagatgcgacctgagctttccttaactcatgcggaaatttacgaatacttatttgaaaat
cgattaaataccaaagttgaaggtcattttattttaccaaaggaaaagggtgaaataaaa
aattctggaggagcgccacatcatatctatggttatttaacgcatgttgtccttgtagag
atagatacattgacgggtgaaacagatgtactgcgagttgtttccattcctgatgccggc
agggtcataaatcctcaggggcttgagggacagacagaaggcggcgcaataatgggaatt
ggttacaccctctacgaagatgtaatcattgaaaacggtattcataaaacaaagaatttt
acggactatatcatccctactattcgtgagacaccaataattgaaacgattccggttgag
gaaccggagccttccaatccattaggcgcgaagggaatcggtgaggtagtcatgatacca
atcattccggcaatcatgaatgctctttatgatgcagttggaattagaatcaaacacctg
ccggcaacacctgaaagaatctttaaagaaatgaagtttttaaaagagaaggtccacccg
caaacgaggtga

DBGET integrated database retrieval system