KEGG   Nakamurella multipartita: Namu_3208
Entry
Namu_3208         CDS       T00991                                 

Name
(GenBank) formate acetyltransferase
  KO
K00656  formate C-acetyltransferase [EC:2.3.1.54]
Organism
nml  Nakamurella multipartita
Pathway
nml00620  Pyruvate metabolism
nml00640  Propanoate metabolism
nml00650  Butanoate metabolism
nml01100  Metabolic pathways
nml01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:nml00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Namu_3208
   00640 Propanoate metabolism
    Namu_3208
   00650 Butanoate metabolism
    Namu_3208
Enzymes [BR:nml01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.54  formate C-acetyltransferase
     Namu_3208
SSDB
Motif
Pfam: PFL-like Gly_radical
Other DBs
NCBI-ProteinID: ACV79539
UniProt: C8XCT6
Position
complement(3533584..3535875)
AA seq 763 aa
MTSYPVTTATRPTGPGATLDAWTGFAPGPWADGVDVRDFIQRNYTPYTGDDSFLTGPTPR
TTAIWQTLAGMFPQERAKGIYDVDAHTPSSITAHAPGYIDKDNEIIVGLQTDAPLKRAIM
PNGGWRMVEDALKTYGYEPDPIVKKIFTSYRKTHNQGVFDVYPPDVRAARRSHIITGLPD
AYGRGRIIGDYRRVALYGVDRLIAAKQADRAELDARASVEDVIRDREENAEQVRALQELV
QMADSYGFDVRRPAATAREAIQWLYLAYLGAVKEQNGAAMSLGRTSTFLDVYLQRDLESG
LITESDAQEMIDDLVIKLRIVRFLRTPEYDALFSGDPTWVTETIGGVGEDGRPLVTRNSF
RMLQTLYNLGPAPEPNLTVLWTDRLPHGFKEFCARVSIDTSAIQYESDDLIRGDWGDDAA
IACCVSAMRVGKQMQFFGARVNLAKALLYAINGGRDEVSGVQVVPATALPAGPVVGDTLD
YDDVQARFDTMLDWLAATYVDALNCVHYMHDKYAYERLEMALHDQTILRTLACGIAGLSV
VADSLAAIKYARVHPVRDESGLVTDYLVDGEFPTFGNDDDRVDEIAVALVREFMDKVRQQ
PSYRGAVHTQSVLTITSNVVYGKATGNTPDGRRKGEPFAPGANPMNGRDRHGMLTSALSV
AKLPYEQAQDGISLTSTVVPSSLGRTKDEQALNLVGLLDAYMIARGFHMNVNVLNRETLQ
DAMEHPENYPQLTIRVSGYAVNFVRLTREQQLDVLSRTFHGAL
NT seq 2292 nt   +upstreamnt  +downstreamnt
atgaccagctatccggtcaccacagccacccgtccgaccggtcccggcgcgaccctggac
gcctggacgggtttcgcgcccggcccctgggccgacggcgtcgacgtgcgggacttcatc
cagcgcaactacacgccctacaccggcgacgacagcttcctgaccggtcccaccccgcgg
accacggccatctggcagaccttggccggcatgtttccgcaggagcgggccaagggcatc
tacgacgtggatgcgcacaccccgtcgtcgatcacggcccacgccccgggctacatcgac
aaggacaacgagatcatcgtcggcctgcagaccgacgccccgctcaagcgggcgatcatg
cccaacggtggctggcggatggtcgaggacgcactcaagacctacggttacgaacccgac
ccgatcgtcaagaagatcttcaccagctatcgcaagacccacaatcagggcgtcttcgac
gtctacccgccggacgtgcgggcggcccgccggtcgcacatcatcaccggcctgcccgat
gcctacggccgcggccgcatcatcggcgactaccggcgcgtggccctgtacggcgtggac
cggctgatcgcggccaagcaggccgaccgggccgagctggacgcccgggcctccgtcgag
gacgtcatccgcgatcgcgaggagaacgccgagcaggtccgggccctgcaggaactggtg
cagatggccgacagctacggcttcgacgtgcgtcgcccggcggccaccgcccgggaggcc
atccagtggctgtacctggcctacctgggtgcggtgaaggagcagaacggcgcggccatg
tcgctgggccggacctcgaccttcctggacgtctacctgcagcgggatctggagtccggc
ctgatcaccgagtccgacgcccaggagatgatcgacgacctggtgatcaagctgcgtatc
gtgcgcttcctgcgcaccccggagtacgacgcgctgttctccggcgacccgacctgggtc
accgagaccatcggcggcgtcggcgaggacggccggccgctggtcacccgcaactcgttc
cggatgctgcagaccctgtacaacctgggcccggcgcccgagccgaacctgaccgtgctg
tggaccgaccggctcccgcacgggttcaaggagttctgcgcgcgggtctcgatcgacacc
tcggccatccagtacgaatccgacgacctgatccgcggcgactggggcgacgacgcggcc
atcgcctgctgcgtctcggcgatgcgggtgggcaagcagatgcagttcttcggcgcccgg
gtcaacctggccaaggctctgctgtatgcgatcaacggtggccgggacgaggtctcgggc
gttcaggtggtgccggcgaccgcgctgccggccggtccggtggtcggcgacacgcttgac
tacgacgacgtgcaggcccggttcgacaccatgctcgactggctggccgcgacctacgtc
gacgcgctcaactgcgtgcactacatgcacgacaagtacgcctacgagcggctggaaatg
gccctgcacgaccagaccatcctgcgcaccctggcctgcggcatcgccggcctgagcgtg
gtggccgactcgctggcggccatcaagtacgcccgggtgcatcccgtgcgcgacgagagt
ggactggtcaccgactatctggtggacggcgagttcccgaccttcggcaacgacgacgac
cgggtggatgagatcgccgtggcgttggtccgcgaatttatggacaaggtccgccagcag
cccagctaccgcggagccgtgcacacccagtcggtgctgaccatcacctcgaacgtggtc
tacggcaaggcgaccggcaacaccccggacggccggcgcaagggcgaaccgttcgccccg
ggcgccaacccgatgaacgggcgggaccggcacggcatgctgaccagcgcgttgtcggtg
gccaagctgccgtacgagcaggcgcaggacggcatctcgctgacctcgaccgtggtgccc
agcagcttgggccgcaccaaggacgagcaggcgctcaatctggtcggtctgctggatgcc
tacatgatcgcccgcggcttccacatgaacgtcaacgtgctcaaccgggagacgctgcag
gacgcgatggagcatccggagaactacccacagctgacgatccgggtgtcggggtacgcg
gtgaacttcgtccggctgacccgcgagcagcagctcgatgtgctctcgcggaccttccac
ggggcgttgtga

DBGET integrated database retrieval system