KEGG   Nakamurella multipartita: Namu_0202Help
Entry
Namu_0202         CDS       T00991                                 

Definition
(GenBank) delta-1-pyrroline-5-carboxylate dehydrogenase
  KO
K00294  1-pyrroline-5-carboxylate dehydrogenase [EC:1.2.1.88]
Organism
nml  Nakamurella multipartita
Pathway
nml00250  Alanine, aspartate and glutamate metabolism
nml00330  Arginine and proline metabolism
nml01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nml00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Namu_0202
   00330 Arginine and proline metabolism
    Namu_0202
Enzymes [BR:nml01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     Namu_0202
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ACV76635
UniProt: C8XJV2
Position
226787..228415
Genome map
AA seq 542 aa AA seqDB search
MDAVTHPPLPVNEPVLNYAPGSPERATLLEALAGFTGPMELGAVIDGAVREPGGAPFTVV
APFDHGRVLGTSAHAVQDDARAAVAAALAAAADWRAMDFDSRAAILLRAADLLVGPWRAR
INAATMLGQAKTAYQAEIDSACELADFWRFNVHFARQILAEQPIANAAGIWNRTDHRPLE
GFVYAVTPFNFTAIAGNLPTAPALMGNVVVWKPSTTQQLAASLTMQLLIEAGLPPGVINM
LPGTGPEISEVVLAHPELAGIHFTGSTRVFQQLWSAVGANIGGYRSYPRLVGETGGKDFV
VAHPSADVDVLRTALVRGAFEYSGQKCSAASRAYLPASLWPALKDGLIEQTEALTVGSVE
DLTNFTSAVIDDRSFGRLKAAIDRAHATDSVTVLAGGRYDDAQGYFVRPTLLLGTDPRDE
AFCTEYFGPILSLYVYPDAEFDAVLREVDQASPYALTGSIIARDRAAVARASAALRYTAG
NFYINDKPTGAVVGQQPFGGARASGTNDKAGSAANLLRWTSPRSIKETFVAPTAVGYPHQ
AQ
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atggacgccgtgacccacccgccgctcccggtgaacgaaccggtcctgaactacgcgccg
gggtcgccggaacgggccaccctgctggaggcgttggccggcttcaccgggccgatggag
ctgggtgcagtcatcgacggggccgtccgggaaccgggcggggcccccttcacggtggtg
gcgccgttcgaccacggccgggtgctgggcacctcggcgcatgcggtgcaggacgacgcc
cgggccgcggtcgccgcggcgctggccgccgcggccgactggcgggcgatggacttcgac
tcgcgcgcggcgatcctgctgcgggcggcggacctgctggtcggaccgtggcgcgcccgg
atcaacgcggccaccatgctcgggcaggccaagaccgcctaccaggcggagatcgactcg
gcctgcgagctggccgacttctggcggttcaacgtgcacttcgcccggcagatcctggcc
gagcagccgatcgccaacgcggccgggatctggaaccgcaccgaccatcggccgttggag
ggcttcgtctacgcggtgacgcccttcaacttcaccgcgatcgccggcaacctgccgacc
gctcccgcgctgatgggcaacgtggtggtgtggaagccgtcgaccacccagcagctggcc
gcctcgctcaccatgcaactgctgatcgaggccggcctgccgccgggcgtgatcaacatg
ctgccgggtaccgggccggagatctcggaggtggtgctggcccatcccgagctggccggt
atccatttcaccgggtcgacccgggtgttccagcagctctggtcggcggtcggggcgaac
atcggcgggtaccgctcctacccccggctggtcggggagaccgggggcaaggacttcgtg
gtcgcccacccgtccgccgacgtggacgtgctgcgcaccgcactggtccggggcgccttc
gagtactccggccagaagtgctcggccgcgtcccgcgcgtacctgcccgcctcgctgtgg
ccggcgctcaaagacggcctgatcgagcagaccgaggcgctgaccgtgggctcggtggag
gacctgaccaacttcaccagcgccgtcatcgacgaccggtccttcggccggctcaaggcg
gccatcgaccgggcgcacgcgaccgactcggtcaccgtgctggccggcggccgctacgac
gacgcccaggggtacttcgtccgcccgaccctgctgctgggcaccgacccgcgggacgag
gccttctgcaccgagtacttcggcccgatcctgtcgctgtacgtctacccggacgccgag
ttcgacgccgtgctgcgcgaggtggaccaggcctcgccgtacgccctgaccggctcgatc
atcgcccgggaccgcgccgccgtggcccgggccagcgcggccctgcggtacaccgccggc
aacttctacatcaacgacaagcccaccggggcggtcgtcgggcagcaaccgttcggcggc
gcccgcgcgtcggggaccaacgacaaggccgggtcggccgcgaacctgctgcgctggacc
tcgccccgctcgatcaaggagacgttcgtcgcgcccaccgcggtgggctacccgcaccag
gcacagtga

DBGET integrated database retrieval system