KEGG   Nakamurella multipartita: Namu_0248Help
Entry
Namu_0248         CDS       T00991                                 

Definition
(GenBank) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
nml  Nakamurella multipartita
Pathway
nml00620  Pyruvate metabolism
nml00630  Glyoxylate and dicarboxylate metabolism
nml01100  Metabolic pathways
nml01110  Biosynthesis of secondary metabolites
nml01120  Microbial metabolism in diverse environments
nml01200  Carbon metabolism
Module
nml_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:nml00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Namu_0248
   00630 Glyoxylate and dicarboxylate metabolism
    Namu_0248
Enzymes [BR:nml01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Namu_0248
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: ACV76678
UniProt: C8XJZ5
Position
complement(277914..279536)
Genome map
AA seq 540 aa AA seqDB search
MGVTLNGPEIARADEILTPDAVAFVADLHRRFAGRRDELLAERTRRRERAARSGRLDVRP
ETAGIRAADWTVAAAPADLVDRRVEITGPPEPKMAINALNSGARVWLADLEDANTPHWRN
VVGGQLVLFDAIRGTLAFDSPDGRPYRLATDRRLATIVARPRGWHFDERHLLVDGEPAVG
ALVDFGLYFFHNAAELLARGSGPYFYLPKMESHLEARLWNDVFTHAQAELGIAHGTIRAT
VLIETIPAAFEMDEILYELREHASGLNAGRWDYLFSVIKYFRDAGPTFVLPDRGSVTMTA
PMMRAYTDLLVATCHRRGAFAMGGMAAFIPSRRDPEVNRAALAKVRADKEREAGDGFDGS
WVAHPDLVPVCAEVFDAVLGDRPNQLDRRRDDVQVTADQLLDVTSVPGSITEAGLRGNID
VALRYLEAWLGGNGAVGIHNLMEDAATAEISRSQVWQWVHHGVQLDTGLTVTAELVCRIA
DEELAAIAAELGSQTYAASQYPLARSVFEQVALADEFADFLTLPAYAAAHDAELAASRQA
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgggcgtcacgctcaacggacccgagatcgcccgcgccgacgagattctcactccggac
gcggtggccttcgtggccgatctgcatcgccgtttcgccggccggcgggacgagctgctg
gccgagcgcacccgccgtcgcgagcgggccgcccgctccggccggctggacgtccggccg
gagaccgcgggcatccgggccgccgactggaccgtcgcggccgccccggccgacctggtc
gaccgccgggtggagatcaccggcccgcccgagccgaagatggccatcaacgccctgaac
tcgggagcgcgggtatggctggccgacctggaggacgcgaacaccccgcactggcgcaac
gtggtcggtgggcagctggtgctcttcgacgccatccgcggcaccctggccttcgattcc
ccggacggccggccctaccggctggccaccgaccggcggctggccaccatcgtcgcccgg
ccgcggggttggcacttcgacgagcgacacctgctggtggacggcgagcccgccgtcggt
gccctggtcgacttcgggctctacttcttccacaacgcggccgaactgctggcccggggc
agcggaccgtacttctacctgccgaagatggagagccatctggaggcgcggctgtggaac
gacgtgttcactcacgcccaggccgaactgggcatcgcccacggcaccatccgggccacc
gtgctgatcgagaccatcccggccgcgttcgagatggacgagattctctatgagctgcgc
gagcacgcgtccggcctgaatgccggccgctgggactacctgttcagcgtcatcaagtac
ttccgtgatgccggccccacgttcgtgctgcccgatcggggcagcgtgaccatgaccgcc
ccgatgatgcgcgcctacaccgacctgctggtggcgacctgccaccgccgcggggcgttc
gcgatgggcggcatggccgccttcatcccgagccggcgggaccccgaggtcaaccgggcc
gccctggccaaggtgcgggcggacaaggaacgggaggccggcgacggcttcgacggctcc
tgggtggcccacccggacctggtcccggtgtgtgccgaggtgttcgacgccgtgctcggc
gaccggcccaaccagctcgaccgccgccgggacgacgtccaggtcacggccgatcagcta
ctggacgtgacctccgtgccgggctcgatcaccgaagccgggctgcgcggcaacatcgac
gtggccctgcgctacctggaggcctggctcggcggcaacggcgccgtcggcatccacaac
ctgatggaggatgcggccaccgcggagatctcccggtcccaggtgtggcagtgggtgcat
cacggtgtgcagctggacaccgggctgaccgtcaccgcggagctggtctgccggatcgcc
gacgaggaactggccgcgatcgccgccgagctgggctcgcagacctacgcggcaagccag
tacccgttggcccgcagcgtcttcgagcaggtggccctggccgacgagttcgccgatttc
ctcaccctgccggcctacgcggcggcccatgatgcggagttggcggccagccgtcaggct
tga

DBGET integrated database retrieval system