KEGG   Nakamurella multipartita: Namu_0803Help
Entry
Namu_0803         CDS       T00991                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
nml  Nakamurella multipartita
Pathway
nml00071  Fatty acid degradation
nml00280  Valine, leucine and isoleucine degradation
nml00281  Geraniol degradation
nml00310  Lysine degradation
nml00360  Phenylalanine metabolism
nml00362  Benzoate degradation
nml00380  Tryptophan metabolism
nml00410  beta-Alanine metabolism
nml00627  Aminobenzoate degradation
nml00640  Propanoate metabolism
nml00650  Butanoate metabolism
nml00903  Limonene and pinene degradation
nml01100  Metabolic pathways
nml01110  Biosynthesis of secondary metabolites
nml01120  Microbial metabolism in diverse environments
nml01130  Biosynthesis of antibiotics
nml01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:nml00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Namu_0803
   00650 Butanoate metabolism
    Namu_0803
  Lipid metabolism
   00071 Fatty acid degradation
    Namu_0803
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Namu_0803
   00310 Lysine degradation
    Namu_0803
   00360 Phenylalanine metabolism
    Namu_0803
   00380 Tryptophan metabolism
    Namu_0803
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Namu_0803
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Namu_0803
   00281 Geraniol degradation
    Namu_0803
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Namu_0803
   00627 Aminobenzoate degradation
    Namu_0803
   00930 Caprolactam degradation
    Namu_0803
Enzymes [BR:nml01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Namu_0803
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_2 ECH_1
Motif
Other DBs
NCBI-ProteinID: ACV77214
UniProt: C8X9E6
Position
885272..886327
Genome map
AA seq 351 aa AA seqDB search
MRHRDGSAIQYLCTDYRGAMNQTEESLVIRVEGRLGRIMLNRPRQINALTLPMIDGIRAA
LAGWADDPAVDVVLIDGAGERGLCAGADIRALRQSILDGSDEAMTFLADEYVMNKALADY
PKPIVADQRGITFGGGLGVSAHCSVRIVAEDSQLAMPETLIGLWPDVGILHLLGRSPGQL
GVHAALIGARLDAGDAIRAGLADHFVPADARPALLDALRAGVVPEFAGPPPAGALQQASW
IDECYAFATAEEILSALLAHPDPAAQAAGQALAGMAPLSVKVTLRAVRAAASMTLAQVLA
QDLRFAAHFMARPDLPEGIPAQVVDKDRNPRWQPARLADVSDADVDAFFTG
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgcggcaccgtgacgggagtgcaatccagtacctgtgcactgattaccgtggcgcgatg
aatcaaaccgaagagtccctggtgatccgggtcgagggccgattgggccggatcatgctg
aaccggccgcggcagatcaacgcgctgacgctgccgatgatcgacggcatccgcgccgcg
ttggccggctgggccgacgaccccgcggtcgacgtcgtgttgatcgacggggcgggcgag
cggggtctgtgcgccggcgccgacatccgggcgctgcggcagtcgattctggacggctcc
gacgaggccatgaccttcctggccgacgagtacgtcatgaacaaggcgctggccgactac
cccaagccgatcgtggccgaccagcgcggcatcaccttcggtggcgggctgggggtctcc
gcgcactgctcggtgcgcatcgtcgcggaggattcgcagctggccatgcccgagacgctg
atcgggctgtggcccgacgtcggcatcctgcacctgctcggccgctcgcccggccagctc
ggggtgcacgccgcgttgatcggggcccggctggacgccggcgacgcgatccgggccggg
ctggccgaccacttcgtgccggctgacgcgcgaccggcgctgctggacgcgctgcgcgcc
ggggtggtccccgagttcgccgggccgccgccggccggggcgctgcagcaggcgagctgg
atcgacgagtgttacgcgttcgccacggccgaggagatcctgagcgccctgctggcccat
ccggacccggccgcgcaggcggccggccaggcgctggccgggatggcgccgctgtcggtc
aaggtgacgctgcgcgcggtccgggcggcggcctcgatgaccctggcgcaggtgctcgcc
caggacctgcggttcgccgcccacttcatggcccggccggacctgcccgaggggatcccc
gcgcaggtggtggacaaggatcgcaacccgcgctggcaaccggcccgcctcgccgacgtc
tccgacgccgacgtggacgccttcttcaccggctga

DBGET integrated database retrieval system