KEGG   Nakamurella multipartita: Namu_1087Help
Entry
Namu_1087         CDS       T00991                                 

Definition
(GenBank) alpha/beta hydrolase fold protein
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
nml  Nakamurella multipartita
Pathway
nml00010  Glycolysis / Gluconeogenesis
nml00020  Citrate cycle (TCA cycle)
nml00620  Pyruvate metabolism
nml01100  Metabolic pathways
nml01110  Biosynthesis of secondary metabolites
nml01120  Microbial metabolism in diverse environments
nml01130  Biosynthesis of antibiotics
nml01200  Carbon metabolism
Module
nml_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:nml00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Namu_1087
   00020 Citrate cycle (TCA cycle)
    Namu_1087
   00620 Pyruvate metabolism
    Namu_1087
Enzymes [BR:nml01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Namu_1087
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_6 Abhydrolase_1 Hydrolase_4 Biotin_lipoyl Biotin_lipoyl_2 Thioesterase DUF676 PGAP1 Abhydrolase_2 Abhydrolase_5 Ser_hydrolase Ndr Abhydrolase_3 Lipase RnfC_N Chlorophyllase2
Motif
Other DBs
NCBI-ProteinID: ACV77495
UniProt: C8XBN3
Position
complement(1207424..1208593)
Genome map
AA seq 389 aa AA seqDB search
MTTTEETAPSQVTDRIQRITMPKWGLSMESGKVTDWFVAEGDELAHGQDICEIDTDKIAG
ALESTWAGTVRALVVDTMVDVPVGGTIALVADADVPQEEIDAALAQAREQLASGDIVDDS
GPKLGTVQLDGTTIAYAVLAPEEPTAETAVVFVHGYGGDKDSWMFVQEPIAADADRPRAT
YALDLPGHGASSKDVGPGTIDSLAAIVIGFLDALELSRVHLVGHSMGGAVVAAVAGSPAA
AGRVSSLTLISPAGVGPQINVEYLRGFAGAQTRRELKPHLLELFADPSLVHRQLIDDLLR
YKRIDGVDVALATLSTHLADGVDVTAALASFGGPTVAVWGAQDAIVPAANASALGSRVPV
HVVDGAGHMAHMEKPHEVVAAIHQAIGTS
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
gtgaccacgacggaagaaaccgcccccagccaagtgaccgaccgcatccagcggatcacc
atgcccaagtggggcctgtcgatggagtccggcaaggtcaccgactggttcgtcgccgag
ggtgacgagctggcccacggccaggacatctgcgagatcgacaccgacaagatcgccggc
gccctggaatcgacctgggccggcaccgtccgggccctggtcgtggacacgatggtggac
gtgccggtgggcggcacgatcgccctggtcgccgacgccgacgtgccgcaggaggagatc
gacgcggcgctggcccaggcccgcgagcagctggcttccggtgacatcgtcgacgattcc
ggcccgaagctgggcaccgtccagctcgacgggaccaccatcgcctacgcggtgctggcc
ccggaggagccgacggcggagacggccgtggtcttcgtgcacgggtacggcggggacaag
gactcctggatgttcgtccaggaacccatcgccgccgacgccgatcggccccgggcgacg
tacgcgctggacctgcccgggcacggcgcgtcgagcaaggacgtcgggcccggcacgatc
gattcgctggccgcgatcgtcatcgggttcctggacgcccttgagctctcccgcgtgcac
ctggtcgggcactcgatgggcggggcggtggtggcggcggtcgccggcagcccggcggcc
gccgggcgggtgtcctcgctgacgctgatctccccggccggcgtcgggccgcagatcaac
gtggagtacctgcgcgggttcgccggggcgcagacccggcgggaactcaagccgcacctg
ctggagctgttcgccgatccgtcgctggtgcaccgccagttgatcgacgacctgttgcgg
tacaagcggatcgacggcgtcgatgtcgccctggccacgttgtccacgcacctggccgac
ggcgtcgacgtgaccgcggcgctggcctcgttcggcggcccgacggtggccgtctggggc
gcgcaggacgccatcgtcccggcggcgaatgcctcggccctgggcagccgggtcccggtg
cacgtggtcgacggggccggacacatggcccacatggaaaagccgcacgaggtggtcgcg
gccattcaccaggccatcggcacgagctga

DBGET integrated database retrieval system