KEGG   Nakamurella multipartita: Namu_1092Help
Entry
Namu_1092         CDS       T00991                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
nml  Nakamurella multipartita
Pathway
nml00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:nml00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Namu_1092
Enzymes [BR:nml01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     Namu_1092
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     Namu_1092
    1.1.1.-  
     Namu_1092
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc ADH_zinc_N_2 UDPG_MGDP_dh_N Pyr_redox_3 OxoDH_E1alpha_N
Motif
Other DBs
NCBI-ProteinID: ACV77500
UniProt: C8XCD5
Position
complement(1212947..1214002)
Genome map
AA seq 351 aa AA seqDB search
MKAAMYYGNKDIRIEEIPEPTVRPGTVKVKIEWCGICGTDLHEYLDGPIFAPPAGSPHPL
TGETVPVCLGHEFAGIVADVGDGVTNVSVGERVVVEPYITCGTCARCRAGIYNVCDTLGF
IGLSGGGGGFSEFVVADAKRTFPIGDLPTDIGALIEPLAVAYHAVRLSKARPGDSATVYG
SGPIGLVTVAALKAQGIENVIVVEPAEVRKVKAAAAGASTVLDPTDTDIVAAIKDLTGGV
GTDVSFECAGFNGATAQAIRATKGGGTVVNVAIWGHEATVAMNDLVFNEVSIIGSLAYCN
DHEPTIKLLQDGKVDAAQFITGKIAVDDIVEGGFRELIDHKAENVKILVHP
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcagccatgtactacgggaacaaggacatccggatcgaggagatccccgagccg
accgtccgcccggggacggtcaaggtcaagatcgagtggtgcgggatctgcggcaccgac
ctgcacgagtacctggacggtcccatcttcgcgccgccggccggatcgccgcacccgctg
accggggaaaccgtgccggtctgcctggggcacgagttcgccgggatcgtcgccgatgtc
ggcgacggcgtcaccaacgtctcggtcggcgagcgggtggtggtcgagccctacatcacc
tgcggcacctgcgcccgctgccgggccggcatctacaacgtctgcgacaccctgggtttc
atcggtctgtccggtgggggcggcggcttctccgaattcgtcgtcgccgacgccaagcgc
accttcccgatcggcgacctgcccaccgacatcggcgcgctgatcgagcccctggccgtg
gcctatcacgcggtccggctgtccaaggcccgcccgggtgacagcgccaccgtctacggg
tccgggcccatcggcctggtcacggtggcggcgctcaaggcgcagggcatcgagaacgtg
atcgtggtggagccggccgaggtccgcaaggtcaaggccgcggcggccggcgcgagcacc
gtgctggacccgacggacaccgacatcgtcgccgcgatcaaggatctcaccggcggtgtg
ggcaccgacgtctcgttcgaatgcgccggcttcaacggggccaccgcgcaggcgatcagg
gcgaccaagggcggcggcaccgtcgtcaacgtggccatctggggccacgaggccaccgtc
gcgatgaacgacctggtcttcaacgaggtgtcgatcatcgggtcgctggcctactgcaac
gaccacgaacccaccatcaagctgctgcaggacggcaaagtcgatgccgcccagttcatc
accggcaagatcgcggtggacgacatcgtcgagggcggtttccgcgagctgatcgaccac
aaggccgagaacgtcaagatcctcgtccacccctga

DBGET integrated database retrieval system