KEGG   Nakamurella multipartita: Namu_1692Help
Entry
Namu_1692         CDS       T00991                                 

Definition
(GenBank) isochorismatase hydrolase
  KO
K08281  nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
nml  Nakamurella multipartita
Pathway
nml00760  Nicotinate and nicotinamide metabolism
nml01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nml00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Namu_1692
Enzymes [BR:nml01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     Namu_1692
    3.5.1.-  
     Namu_1692
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Isochorismatase
Motif
Other DBs
NCBI-ProteinID: ACV78082
UniProt: C8XFX1
Position
complement(1859316..1859951)
Genome map
AA seq 211 aa AA seqDB search
MTHSPTPDAPTSTPTWTHGPDHALLVVDMQHDFGHPEGSLFVQGAPDIVEPINRAIEQAL
AAGHLVVYTRDWHPEVTPHFAEHGGLWPAHCVIESAGAEFLPGITVDGPVVHKGSGPEDG
YSGFSVLHLPTGQNRETDLSAILDENGVMAVTVVGLAGDWCVKSTAIDAVRLGYRTLVPL
ALTRFVELNPGDTEAAIEAMRQAGVQVIEAD
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgacccattcaccgacgcccgatgccccgaccagcaccccgacctggacccacggaccc
gaccacgcgctgctggtggtcgacatgcagcacgacttcggtcacccggagggctcgctg
ttcgtccagggcgccccggacatcgtcgagccgatcaaccgggccatcgaacaggccctg
gccgccggccacctggtggtctacacccgggactggcacccggaggtgaccccgcacttt
gccgagcacggcgggctgtggccggcgcactgcgtcatcgaatcggccggggccgagttc
ctgcccgggatcacggtcgacgggccggtcgtgcacaagggctccggcccggaggacggc
tacagcgggttcagcgtgctgcacctgccgaccgggcagaaccgggagaccgacctgtcg
gcgatcctggacgagaacggcgtcatggccgtgacggtcgtcggactggccggcgactgg
tgcgtcaagtccaccgccatcgacgcggtccggctgggctaccgcaccctcgtgccgctg
gccctgacccggttcgtcgagctcaacccgggtgacaccgaggccgcgatcgaggccatg
cggcaagccggcgtgcaggtgatcgaggccgactga

DBGET integrated database retrieval system