KEGG   Nakamurella multipartita: Namu_2092Help
Entry
Namu_2092         CDS       T00991                                 

Definition
(GenBank) arginyl-tRNA synthetase
  KO
K01887  arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
nml  Nakamurella multipartita
Pathway
nml00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:nml00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Namu_2092
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:nml01007]
    Namu_2092
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:nml03016]
    Namu_2092
   03029 Mitochondrial biogenesis [BR:nml03029]
    Namu_2092
Enzymes [BR:nml01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.19  arginine---tRNA ligase
     Namu_2092
Amino acid related enzymes [BR:nml01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   Namu_2092
Transfer RNA biogenesis [BR:nml03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Namu_2092
 Prokaryotic Type
   Other AARSs
    Namu_2092
Mitochondrial biogenesis [BR:nml03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Namu_2092
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DALR_1 Arg_tRNA_synt_N tRNA-synt_1d tRNA-synt_1 tRNA-synt_1g tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: ACV78470
UniProt: C8XIA1
Position
2309273..2310928
Genome map
AA seq 551 aa AA seqDB search
MQLADAVRRALTSAVAAGDLAVEVPADIPLDRPKSREHGDYATPVAMKLAKAAHRPPRQI
AEIIAAHLADEPGIAGVSIAGPGFLNISVETAAAASLVGRIVADGAAYGHGDALAGRQVN
LEFVSANPTGPIHIGGARWAAVGDALGRILSTQGATVIREYYFNDAGAQIDRFARSLLAA
ARQQPAPEDGYGGDYIVEIAGRITAANPGAPQLPDDQATELYRAQGVELMFDEIKATLHT
FRTDFDVYFHENSLHESGAVGQAVQRLKDSGHLTFNDGAWWLNSKAYGDDKDRVVIKSDG
QPAYIAGDLAYFLDKRARGFDLCIYMLGADHHGYIARLKAAAAAFGDDPDVVEVLIGQMV
NLVRDGEPIRMSKRAGTVITLDDLIEALGVDAARYALIRYSVDTTLDLDLDLWTRQTSDN
PVFYVQYAHARLASLARNAADLGIELGLRSGGAYDPALLDTARESELIALLAAWPGVLAT
AAELREPHRVARYLEDLASGYHKFYDSVRVLPMGDEEAGPATIARLWLCAATRQVLANGL
AVLGVDAPERM
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
gtgcagttggccgatgccgttcggcgtgccctgacgtcggcggtcgccgccggcgacctc
gcggtcgaggtgccggccgacattccgttggaccgacccaagtcccgggagcacggcgac
tacgccaccccggtggcgatgaagctggccaaggcggctcaccggccgccgcggcagatc
gccgagatcatcgccgcgcacctggccgacgagcccgggatcgccggcgtgagcatcgcc
gggccgggctttttgaacatctcggtggagaccgcggccgccgcctcgctggtcggccgg
atcgtggccgacggcgccgcctacggccacggggacgcgctggccggccgccaggtcaac
ctggagttcgtctcggccaacccgaccgggccgatccatatcggcggcgcccgttgggcc
gccgtcggcgacgcgttgggccggatcctgagcacccagggcgccacggtcatccgcgag
tactacttcaacgacgccggcgcgcagatcgaccggttcgcgcgctcgctactggccgcc
gcccggcagcagccggcgcccgaggacggttacggcggggactacatcgtcgagatcgcc
ggccggatcacggcggccaacccgggcgcgccgcagctgcccgacgaccaggccaccgag
ctgtaccgcgcgcagggcgtcgagctgatgttcgacgagatcaaggccaccctgcacacc
ttccgcaccgacttcgacgtctacttccacgagaactcgctgcacgagagcggggcggtg
ggccaggcggtgcagcggctcaaggattccgggcacctgaccttcaatgacggcgcctgg
tggctgaactccaaggcctacggcgacgacaaggaccgggtggtcatcaagtccgacggc
cagcccgcgtacatcgccggcgacctggcctacttcctggacaagcgggcccgcggcttc
gacctgtgcatctacatgctcggggccgatcaccacgggtatatcgcccggctcaaggcc
gccgccgccgcgttcggcgacgatccggatgtggtcgaggtgctcatcggccagatggtc
aacctggtccgcgacggcgagccgatccggatgagcaagcgcgccggcaccgtcatcacc
ctggacgacctgatcgaggcgctcggggtggacgccgcccggtacgcgctgatccgctac
tcggtggacaccacgctggacctggacctggacctgtggacccggcagaccagcgacaac
ccggtgttctacgtccagtacgcgcacgcccggctggcctcgctggcccgcaatgcggcc
gacctgggcatcgagctgggcctgcgatcgggaggggcctacgaccccgctctgctggac
accgcccgcgagtccgagctgatcgccctgctggccgcctggccgggagtgctggccacc
gccgcagagctgcgcgaaccgcaccgggtcgcccgctacctggaggatctggcctccggc
taccacaagttctacgactcggtccgggtgcttccgatgggtgacgaggaggccgggccg
gcgacgatcgcccggctgtggctgtgtgccgccacccggcaggtgctggccaacggtctg
gccgtgctgggcgtcgacgcgccggagcggatgtga

DBGET integrated database retrieval system