KEGG   Nakamurella multipartita: Namu_2115Help
Entry
Namu_2115         CDS       T00991                                 

Definition
(GenBank) catalytic domain of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
nml  Nakamurella multipartita
Pathway
nml00010  Glycolysis / Gluconeogenesis
nml00020  Citrate cycle (TCA cycle)
nml00620  Pyruvate metabolism
nml01100  Metabolic pathways
nml01110  Biosynthesis of secondary metabolites
nml01120  Microbial metabolism in diverse environments
nml01130  Biosynthesis of antibiotics
nml01200  Carbon metabolism
Module
nml_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:nml00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Namu_2115
   00020 Citrate cycle (TCA cycle)
    Namu_2115
   00620 Pyruvate metabolism
    Namu_2115
Enzymes [BR:nml01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Namu_2115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: ACV78493
UniProt: C8XIC4
Position
2334381..2335694
Genome map
AA seq 437 aa AA seqDB search
MAHLLRMPEVAAGGTRAVLATWSVAENAAYTERDTLAEIETDKATVDLDADADGVVLRLL
VAAGAEVGVGDPIALLGGPDEREGDVAALLAGFGVPTNPASGPGPQTRAEPDAAGSVGGS
PAAEGTSPEEGPARLFASPLARTLARAAGLDLTRLAPDSGPGGRIRRVDVQAALADRDGA
SESRAPSGPGDGAPPGGRPVSDGRTEPVPPGAGFVDLPHSRSRRAIATRLTESARTVPHF
YLEGTARVDALLALRRELNEDAPRRISINDLIVKAAARAHRLVPELNVIWTPQAVRRFDH
VDIGVAVAAERGLVTPTLRGVDTLSIGAVAEQTADLIRRADAGRLRPEELTGGALCVTNL
GMFGTERFSAIINPPQSAILAVGAAREEPIVVDGRLAVGTVLKVTVSVDHRAVDGREAAG
WLRTFLAILEKPVRILT
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atggcacacctgttgcgcatgcccgaggtcgccgccggcggcacccgcgccgtgctggcc
acctggtcggtcgccgagaacgccgcctacacggaacgggacaccctggccgagatcgag
accgacaaggcgaccgttgatctggacgccgacgcggacggcgtcgtgctgcgactgctg
gtcgccgccggggccgaggtcggcgtcggcgacccgatcgcgctgctcggcggcccggac
gagcgggagggggacgttgccgccctgctcgccggattcggtgtgcccacgaacccggcc
agcggcccgggaccgcagacgcgggccgagccggacgcggccgggtcggtcgggggctcg
ccagcggccgagggcacctcgcccgaggagggtccggcgcgcctgttcgccagcccgctg
gcccgaacgctggcccgggcggccgggctcgacctcacgcgtctggcacccgactcgggc
ccgggtggccggatccgccgggtcgacgtccaggcggccctggccgaccgcgacggcgct
tcggagtcgcgggcgccgtccggcccgggggacggggccccgccgggcggccggccggtg
tccgatggacgcaccgagccggtgccgcccggtgccggcttcgtcgacctgccgcactcc
cgatcgcgtcgggccatcgccacccggttgaccgagagcgcccggacggtgccgcacttc
tacctggagggcaccgcccgggtggacgcgttgctagccctccggcgcgagctcaacgag
gacgctccgcgacggatctcgatcaacgacctgatcgtcaaggcggccgcgcgggctcac
cggctggtgcccgagctgaacgtgatctggaccccgcaggcggtgcgccgcttcgaccat
gtcgacatcggggtggcggtcgccgccgagcgcggactggtcaccccgaccctgcggggg
gtggacacgctgtccatcggcgcggtcgccgagcagaccgccgatctgatccggcgggcg
gacgccggccggctccgacccgaggaactgaccggcggggccttgtgcgtgaccaacctg
ggcatgttcggcaccgagcggttcagcgcgatcatcaacccgccgcagtcggccatcctg
gcggtcggcgcggcccgcgaggagccgatcgtggtcgacgggcggctggcggtgggcacc
gtgctgaaggtgacggtgtcggtggatcatcgggcggtcgacggccgggaggcggccggc
tggctgcggaccttcctggcgatcctggaaaagccggtgcgcatcctgacctga

DBGET integrated database retrieval system